+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
  • Argentina
  • Australia
  • Austria
  • Bahrain
  • Belgium
  • Brazil
  • Bulgaria
  • Cameroon
  • Canada
  • Chile
  • China
  • Colombia
  • Croatia
  • Cyprus
  • Czech Republic
  • Denmark
  • Ecuador
  • Egypt
  • Estonia
  • Finland
  • France
  • Germany
  • Greece
  • Hong Kong
  • Hungary
  • Iceland
  • India
  • Indonesia
  • Iran
  • Ireland
  • Israel
  • Italy
  • Japan
  • Kazakhstan
  • Kuwait
  • Latvia
  • Lithuania
  • Luxembourg
  • Macedonia
  • Malaysia
  • Malta
  • Mexico
  • Monaco
  • Morocco
  • Netherlands
  • New Zealand
  • Nigeria
  • Norway
  • Peru
  • Philippines
  • Poland
  • Portugal
  • Qatar
  • Romania
  • Russia
  • Saudi Arabia
  • Serbia
  • Singapore
  • Slovakia
  • Slovenia
  • South Africa
  • South Korea
  • Spain
  • Sri Lanka
  • Sweden
  • Switzerland
  • Taiwan
  • Thailand
  • Turkey
  • Ukraine
  • UAE
  • United Kingdom
  • United States
  • Venezuela
  • Vietnam
Antibodies.com Logo Antibodies.com Logo
Sign In/Register
0

Anti-Interferon alpha/beta receptor 1 Antibody (A308248)

Western Blot - Anti-Interferon alpha/beta receptor 1 Antibody (A308248) - Antibodies.com Immunohistochemistry - Anti-Interferon alpha/beta receptor 1 Antibody (A308248) - Antibodies.com Immunohistochemistry - Anti-Interferon alpha/beta receptor 1 Antibody (A308248) - Antibodies.com Immunofluorescence - Anti-Interferon alpha/beta receptor 1 Antibody (A308248) - Antibodies.com Immunofluorescence - Anti-Interferon alpha/beta receptor 1 Antibody (A308248) - Antibodies.com Immunofluorescence - Anti-Interferon alpha/beta receptor 1 Antibody (A308248) - Antibodies.com
$355
Product Datasheet

Rabbit polyclonal antibody to Interferon alpha/beta receptor 1 for WB, IHC and ICC/IF.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 7-10 business days.

  • Specifications

Name
Anti-Interferon alpha/beta receptor 1 Antibody
Description
Rabbit polyclonal antibody to Interferon alpha/beta receptor 1.
Applications
WB, IHC, ICC/IF
Dilutions
WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200
Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 470-557 of human IFNAR1 (NP_000620.2).
Sequence
PSLKPSSSIDEYFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Concentration
Lot Specific
Molecular Weight
64 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles.
Synonyms
CRF2-1, Cytokine receptor class-II member 1, Cytokine receptor family 2 member 1, IFN-alpha/beta receptor 1, IFN-R-1, IFNAR, Type I interferon receptor 1
Isotype Controls
Suitable Secondaries
See all Anti-Rabbit IgG Secondaries →
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.

  • Scientific Validation DataValidation Data (6)

Western Blot - Anti-Interferon alpha/beta receptor 1 Antibody (A308248) - Antibodies.comEnlarge Image

Western Blot - Anti-Interferon alpha/beta receptor 1 Antibody (A308248)

Western blot analysis of extracts of various cell lines, using Anti-Interferon alpha/beta receptor 1 Antibody (A308248) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 3s.
Immunohistochemistry - Anti-Interferon alpha/beta receptor 1 Antibody (A308248) - Antibodies.comEnlarge Image

Immunohistochemistry - Anti-Interferon alpha/beta receptor 1 Antibody (A308248)

Immunohistochemistry analysis of paraffin-embedded mouse brain using Anti-Interferon alpha/beta receptor 1 Antibody (A308248) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-Interferon alpha/beta receptor 1 Antibody (A308248) - Antibodies.comEnlarge Image

Immunohistochemistry - Anti-Interferon alpha/beta receptor 1 Antibody (A308248)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using Anti-Interferon alpha/beta receptor 1 Antibody (A308248) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence - Anti-Interferon alpha/beta receptor 1 Antibody (A308248) - Antibodies.comEnlarge Image

Immunofluorescence - Anti-Interferon alpha/beta receptor 1 Antibody (A308248)

Immunofluorescence analysis of C6 cells using Anti-Interferon alpha/beta receptor 1 Antibody (A308248) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).
Publishing research using Anti-Interferon alpha/beta receptor 1 Antibody (A308248)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-Interferon alpha/beta receptor 1 Antibody (A308248)

slide 7 to 10 of 8
SDS-PAGE - Anti-Interferon alpha/beta Receptor 1 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free (A323863) - Antibodies.com
(3)
A323863
Anti-Interferon alpha/beta Receptor 1 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free
Recombinant human monoclonal antibody to Interferon alpha/beta Receptor 1 for ELISA, FACS, Functional Assay and In Vivo.
ELISA - Anifrolumab Biosimilar - Anti-Interferon alpha/beta Receptor 1 Antibody - BSA and Azide free (A318850) - Antibodies.com
(4)
A318850
Anifrolumab Biosimilar - Anti-Interferon alpha/beta Receptor 1 Antibody - BSA and Azide free
Recombinant human monoclonal antibody to Interferon alpha/beta Receptor 1 for ELISA and Flow Cytometry.
SDS-PAGE - Anifrolumab Biosimilar - Anti-Interferon alpha/beta Receptor 1 Antibody - Low endotoxin, Azide free (A323283) - Antibodies.com
(3)
A323283
Anifrolumab Biosimilar - Anti-Interferon alpha/beta Receptor 1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to Interferon alpha/beta Receptor 1 for ELISA, FACS, Functional Assay and In Vivo.
Western Blot - Anti-Interferon alpha/beta receptor 1 Antibody (A8960) - Antibodies.com
(3)
A8960
Anti-Interferon alpha/beta receptor 1 Antibody
Rabbit polyclonal antibody to Interferon alpha/beta receptor 1 for WB and IHC.
slide 7 to 10 of 8
SDS-PAGE - Anti-Interferon alpha/beta Receptor 1 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free (A323863) - Antibodies.com
(3)
A323863
Anti-Interferon alpha/beta Receptor 1 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free
Recombinant human monoclonal antibody to Interferon alpha/beta Receptor 1 for ELISA, FACS, Functional Assay and In Vivo.
ELISA - Anifrolumab Biosimilar - Anti-Interferon alpha/beta Receptor 1 Antibody - BSA and Azide free (A318850) - Antibodies.com
(4)
A318850
Anifrolumab Biosimilar - Anti-Interferon alpha/beta Receptor 1 Antibody - BSA and Azide free
Recombinant human monoclonal antibody to Interferon alpha/beta Receptor 1 for ELISA and Flow Cytometry.
SDS-PAGE - Anifrolumab Biosimilar - Anti-Interferon alpha/beta Receptor 1 Antibody - Low endotoxin, Azide free (A323283) - Antibodies.com
(3)
A323283
Anifrolumab Biosimilar - Anti-Interferon alpha/beta Receptor 1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to Interferon alpha/beta Receptor 1 for ELISA, FACS, Functional Assay and In Vivo.
Western Blot - Anti-Interferon alpha/beta receptor 1 Antibody (A8960) - Antibodies.com
(3)
A8960
Anti-Interferon alpha/beta receptor 1 Antibody
Rabbit polyclonal antibody to Interferon alpha/beta receptor 1 for WB and IHC.
See all Interferon alpha/beta receptor 1 Antibodies