Anti-Integrin alpha 2 Antibody (A10175)

Anti-Integrin alpha 2 Antibody

Rabbit polyclonal antibody to Integrin alpha 2.

WB, IHC, ICC/IF

WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Integrin alpha 2 (ITGA2/CD49b) (NP_002194.2).

MGPERTGAAPLPLLLVLALSQGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTS

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

BR, CD 49b, CD49 antigen like family member B, CD49 antigen-like family member B, CD49b, CD49b antigen, Collagen receptor, DX5, Glycoprotein Ia deficiency included, GP Ia, GP Ia deficiency, included, GPIa, HPA 5 included, HPA5 included, Human platelet alloantigen system 5, Integrin alpha II, Integrin alpha-2, Integrin, alpha 2 (CD49B alpha 2 subunit of VLA 2 receptor), ITA2_HUMAN, ITGA2, Platelet alloantigen Br(a), included, Platelet antigen Br, Platelet glycoprotein GPIa, Platelet glycoprotein Ia, Platelet glycoprotein Ia/IIa, Platelet membrane glycoprotein Ia, Platelet receptor for collagen, deficiency of, included, Very late activation protein 2 receptor alpha 2 subunit, VLA 2, VLA 2 alpha chain, VLA 2 subunit alpha, VLA-2 subunit alpha, VLA2, VLA2 receptor alpha 2 subunit, VLAA2