Anti-Indoleamine 2, 3-dioxygenase Antibody [10.1] (A278711)

Anti-Indoleamine 2, 3-dioxygenase Antibody [10.1]

Mouse monoclonal [10.1] antibody to Indoleamine 2, 3-dioxygenase.

This antibody recognises Indoleamine-pyrrole 2,3 - dioxygenase (IDO), an enzyme responsible for the catabolism of tryptophan to N-formylkynurenine and kynurenine. With the exception of tryptophan oxidase in hepatocytes, IDO is the only enzyme that degrades the amino acid tryptophan to kynurenine. Chlamydial pathogens require tryptophan for growth. IDO can lower available tryptophan in target cells leading to conversion of the pathogen to persistant forms, with significance in the progression to chronic infection with its associated pathological effects.

IHC-Fr, WB

Human, Mouse

A peptide corresponding to amino acids 78-184 of human IDO fused to GST.

LARLVLGCITMAYVWGKGHGDVRKVLPRNIAVPYCQLSKKLELPPILVYADCVLANWKKKDPNKPLTYENMDVLFSFRDGDCSKGFFLVSLLVEIAAASAIKVIPTV

Mouse

Monoclonal

10.1

IgG3

Unconjugated

45 kDa in IFN-gamma treated human cell lines. This antibody recognizes a slightly lower molecular weight band in Mouse IDO compared to its human counterpart.

Liquid

Supplied in Phosphate Buffered Saline with 0.1% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at 4°C.

Mouse anti Human Indoleamine 2,3-Dioxygenase antibody, clone 10.1 recognizes Indoleamine-pyrrole 2,3 - dioxygenase (IDO), an enzyme responsible for the catabolism of tryptophan to N-formylkynurenine and kynurenine. With the exception of tryptophan oxidase in hepatocytes, IDO is the only enzyme that degrades the amino acid tryptophan to kynurenine. Chlamydial pathogens require tryptophan for growth. IDO can lower available tryptophan in target cells leading to conversion of the pathogen to persistant forms, with significance in the progression to chronic infection with its associated pathological effects.

3-dioxygenase, I23O1_HUMAN, IDO, IDO 1, IDO-1, IDO1, INDO, indolamine 2,3 dioxygenase, Indole 2 3 dioxygenase, indoleamine 2 3 dioxygenase, indoleamine 2 3 dioxygenase 1, Indoleamine 2,3-dioxygenase 1, Indoleamine pyrrole 2 3 dioxygenase, Indoleamine-pyrrole 2