+1 (314) 370-6046 or
Contact Us
Explore our End of Year Promotion >>
Antibodies.com LogoAntibodies.com Logo
Sign In / RegisterMy Account
0

Anti-IL-13 Antibody (A13859)

Western Blot - Anti-IL-13 Antibody (A13859) - Antibodies.com Immunohistochemistry - Anti-IL-13 Antibody (A13859) - Antibodies.com Immunohistochemistry - Anti-IL-13 Antibody (A13859) - Antibodies.com Immunohistochemistry - Anti-IL-13 Antibody (A13859) - Antibodies.com
$335
Product Datasheet

Rabbit polyclonal antibody to IL-13 for WB and IHC.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Freight Charges
$40 to United States
Lead Time
5-8 Business Days

Telephone
+1 (314) 370-6046
Mon - Fri, 8am - 4pm AST
Email
orders@antibodies.com

Name
Anti-IL-13 Antibody
Description
Rabbit polyclonal antibody to IL-13.
Applications
WB, IHC
Dilutions
WB: 1:100-1:500, IHC: 1:50-1:100
Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 34-146 of human IL13 (NP_002179.2).
Sequence
PGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
13 kDa / 17 - 35 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
Allergic rhinitis, ALRH, BHR1, Bronchial hyperresponsiveness 1 (bronchial asthma), IL 13, IL13, IL13_HUMAN, Interleukin 13, Interleukin-13, MGC116786, MGC116788, MGC116789, NC30, P600
Isotype Controls
Suitable Secondaries
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Western Blot - Anti-IL-13 Antibody (A13859) - Antibodies.comEnlarge Image
Figure 1: Western Blot - Anti-IL-13 Antibody (A13859)
Western blot analysis of extracts of Recombinant Human IL13/ALRH/P600 Protein, using Anti-IL-13 Antibody (A13859) at 1:500 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 3s.
Immunohistochemistry - Anti-IL-13 Antibody (A13859) - Antibodies.comEnlarge Image
Figure 2: Immunohistochemistry - Anti-IL-13 Antibody (A13859)
Immunohistochemistry analysis of paraffin-embedded mouse brain using Anti-IL-13 Antibody (A13859) (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-IL-13 Antibody (A13859) - Antibodies.comEnlarge Image
Figure 3: Immunohistochemistry - Anti-IL-13 Antibody (A13859)
Immunohistochemistry analysis of paraffin-embedded rat brain using Anti-IL-13 Antibody (A13859) (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-IL-13 Antibody (A13859) - Antibodies.comEnlarge Image
Figure 4: Immunohistochemistry - Anti-IL-13 Antibody (A13859)
Immunohistochemistry analysis of paraffin-embedded human stomach using Anti-IL-13 Antibody (A13859) (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Publishing research using Anti-IL-13 Antibody (A13859)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-IL-13 Antibody (A13859)

SDS-PAGE - Abrezekimab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free (A323264) - Antibodies.com
(2)
A323264
Abrezekimab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-13 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Dectrekumab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free (A323385) - Antibodies.com
(2)
A323385
Dectrekumab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-13 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Lebrikizumab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free (A323534) - Antibodies.com
(2)
A323534
Lebrikizumab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to IL-13 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Tralokinumab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free (A323799) - Antibodies.com
(2)
A323799
Tralokinumab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-13 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-IL-13 Antibody [GSK 679586] - Low endotoxin, Azide free (A324073) - Antibodies.com
(2)
A324073
Anti-IL-13 Antibody [GSK 679586] - Low endotoxin, Azide free
Recombinant human monoclonal [GSK 679586] antibody to IL-13 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-IL-13 Antibody [CNTO 607] - Low endotoxin, Azide free (A324074) - Antibodies.com
(2)
A324074
Anti-IL-13 Antibody [CNTO 607] - Low endotoxin, Azide free
Recombinant human monoclonal [CNTO 607] antibody to IL-13 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-IL-13 Antibody [H2L6] - Low endotoxin, Azide free (A324075) - Antibodies.com
(2)
A324075
Anti-IL-13 Antibody [H2L6] - Low endotoxin, Azide free
Recombinant human monoclonal [H2L6] antibody to IL-13 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-IL-13 Antibody [IMA-026] - Low endotoxin, Azide free (A324076) - Antibodies.com
(2)
A324076
Anti-IL-13 Antibody [IMA-026] - Low endotoxin, Azide free
Recombinant human monoclonal [IMA-026] antibody to IL-13 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anrukinzumab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free (A323284) - Antibodies.com
(2)
A323284
Anrukinzumab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to IL-13 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Cendakimab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free (A323349) - Antibodies.com
(2)
A323349
Cendakimab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-13 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-IL-13 Antibody [M1295] - Low endotoxin, Azide free (A324072) - Antibodies.com
(2)
A324072
Anti-IL-13 Antibody [M1295] - Low endotoxin, Azide free
Recombinant human monoclonal [M1295] antibody to IL-13 for ELISA, FACS, Functional Assay and In Vivo.
Antibodies.com Image Placeholder - Discover more for less
A269863
Anti-IL-13 Antibody [IL13-I]
Mouse monoclonal [IL13-I] antibody to IL-13 for ELISpot, FluoroSpot and ELISA.
SDS-PAGE - Abrezekimab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free (A323264) - Antibodies.com
(2)
A323264
Abrezekimab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-13 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Dectrekumab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free (A323385) - Antibodies.com
(2)
A323385
Dectrekumab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-13 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Lebrikizumab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free (A323534) - Antibodies.com
(2)
A323534
Lebrikizumab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to IL-13 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Tralokinumab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free (A323799) - Antibodies.com
(2)
A323799
Tralokinumab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-13 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-IL-13 Antibody [GSK 679586] - Low endotoxin, Azide free (A324073) - Antibodies.com
(2)
A324073
Anti-IL-13 Antibody [GSK 679586] - Low endotoxin, Azide free
Recombinant human monoclonal [GSK 679586] antibody to IL-13 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-IL-13 Antibody [CNTO 607] - Low endotoxin, Azide free (A324074) - Antibodies.com
(2)
A324074
Anti-IL-13 Antibody [CNTO 607] - Low endotoxin, Azide free
Recombinant human monoclonal [CNTO 607] antibody to IL-13 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-IL-13 Antibody [H2L6] - Low endotoxin, Azide free (A324075) - Antibodies.com
(2)
A324075
Anti-IL-13 Antibody [H2L6] - Low endotoxin, Azide free
Recombinant human monoclonal [H2L6] antibody to IL-13 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-IL-13 Antibody [IMA-026] - Low endotoxin, Azide free (A324076) - Antibodies.com
(2)
A324076
Anti-IL-13 Antibody [IMA-026] - Low endotoxin, Azide free
Recombinant human monoclonal [IMA-026] antibody to IL-13 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anrukinzumab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free (A323284) - Antibodies.com
(2)
A323284
Anrukinzumab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to IL-13 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Cendakimab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free (A323349) - Antibodies.com
(2)
A323349
Cendakimab Biosimilar - Anti-IL-13 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-13 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-IL-13 Antibody [M1295] - Low endotoxin, Azide free (A324072) - Antibodies.com
(2)
A324072
Anti-IL-13 Antibody [M1295] - Low endotoxin, Azide free
Recombinant human monoclonal [M1295] antibody to IL-13 for ELISA, FACS, Functional Assay and In Vivo.
Antibodies.com Image Placeholder - Discover more for less
A269863
Anti-IL-13 Antibody [IL13-I]
Mouse monoclonal [IL13-I] antibody to IL-13 for ELISpot, FluoroSpot and ELISA.
See all IL-13 Antibodies
Main Menu Contact Us 0Checkout
Top