Anti-IGFBP1 Antibody [ARC0671] (A80700)

Anti-IGFBP1 Antibody [ARC0671]

Rabbit monoclonal [ARC0671] antibody to IGFBP1.

WB: 1:500-1:2,000

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 160-259 of human IGFBP1 (P08833).

GSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN

Rabbit

Monoclonal

ARC0671

IgG

Affinity purification.

30 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

AFBP, Alpha pregnancy associated endometrial globulin, Amniotic fluid binding protein, Binding protein 25, Binding protein 26, Binding protein 28, Growth hormone independent binding protein, hIGFBP 1, hIGFBP1, IBP 1, IBP-1, IBP1, IBP1_HUMAN, IGF binding protein 1, IGF BP25, IGF-binding protein 1, IGFBP 1, IGFBP-1, Insulin like growth factor binding protein 1, Insulin-like growth factor-binding protein 1, Placental protein 12, PP 12, PP12