Anti-IGFBP1 Antibody (A80658)

Anti-IGFBP1 Antibody

Rabbit polyclonal antibody to IGFBP1.

WB: 1:500-1:1,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 81-259 of human IGFBP1 (NP_000587.1).

GLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN

Rabbit

Polyclonal

IgG

Unconjugated

30 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

AFBP, Alpha pregnancy associated endometrial globulin, Amniotic fluid binding protein, Binding protein 25, Binding protein 26, Binding protein 28, Growth hormone independent binding protein, hIGFBP 1, hIGFBP1, IBP 1, IBP-1, IBP1, IBP1_HUMAN, IGF binding protein 1, IGF BP25, IGF-binding protein 1, IGFBP 1, IGFBP-1, Insulin like growth factor binding protein 1, Insulin-like growth factor-binding protein 1, Placental protein 12, PP 12, PP12