+1 (314) 370-6046 or
Contact Us
Explore our End of Year Promotion >>
Antibodies.com LogoAntibodies.com Logo
Sign In / RegisterMy Account
0

Anti-IGF1 Receptor Antibody (A11131)

Western Blot - Anti-IGF1 Receptor Antibody (A11131) - Antibodies.com Western Blot - Anti-IGF1 Receptor Antibody (A11131) - Antibodies.com
Knockout Validated
$470
Product Datasheet

Rabbit polyclonal antibody to IGF1 Receptor for WB.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Freight Charges
$40 to United States
Lead Time
5-8 Business Days

Telephone
+1 (314) 370-6046
Mon - Fri, 8am - 4pm AST
Email
orders@antibodies.com

Name
Anti-IGF1 Receptor Antibody
Description
Rabbit polyclonal antibody to IGF1 Receptor.
Applications
WB
Dilutions
WB: 1:1,000-1:5,000
Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1201-1367 of human IGF1R (NP_000866.1).
Sequence
VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
100 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
CD221, CD221 antigen, IGF 1 receptor, IGF 1R, IGF I receptor, IGF-I receptor, Igf1r, IGF1R_HUMAN, IGFIR, IGFIRC, IGFR, Insulin like growth factor 1 receptor, Insulin like growth factor 1 receptor precursor, Insulin-like growth factor 1 receptor beta chain, Insulin-like growth factor I receptor, JTK13, MGC142170, MGC142172, MGC18216, Soluble IGF1R variant 1, Soluble IGF1R variant 2
Isotype Controls
Suitable Secondaries
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Western Blot - Anti-IGF1 Receptor Antibody (A11131) - Antibodies.comEnlarge Image
Figure 1: Western Blot - Anti-IGF1 Receptor Antibody (A11131)
Western blot analysis of extracts from normal (control) and IGF1R knockout (KO) 293T cells, using Anti-IGF1 Receptor Antibody (A11131) at 1:3,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 10s.
Western Blot - Anti-IGF1 Receptor Antibody (A11131) - Antibodies.comEnlarge Image
Figure 2: Western Blot - Anti-IGF1 Receptor Antibody (A11131)
Western blot analysis of extracts of various cell lines, using Anti-IGF1 Receptor Antibody (A11131) at 1:3,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 10s.
Publishing research using Anti-IGF1 Receptor Antibody (A11131)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-IGF1 Receptor Antibody (A11131)

Western Blot - Anti-IGF1R (phospho Tyr1165 + Tyr1166) Antibody (A7115) - Antibodies.com
(3)
A94889
Anti-IGF1R (phospho Tyr1165 + Tyr1166) Antibody
Rabbit polyclonal antibody to IGF1R (phospho Tyr1165 + Tyr1166) for WB and ELISA.
SDS-PAGE - Teprotumumab Biosimilar - Anti-IGF1 Receptor Antibody - Low endotoxin, Azide free (A323774) - Antibodies.com
(4)
A323774
Teprotumumab Biosimilar - Anti-IGF1 Receptor Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IGF1 Receptor for ELISA, FACS, Functional Assay and In Vivo.
Western Blot - Anti-IGF1R Antibody (B8042) - Antibodies.com
(3)
A95858
Anti-IGF1R Antibody
Rabbit polyclonal antibody to IGF1R for WB, IHC and ELISA.
Western Blot - Anti-IGF1R Antibody (B7115) - Antibodies.com
(4)
A97471
Anti-IGF1R Antibody
Rabbit polyclonal antibody to IGF1R for WB and ELISA.
SDS-PAGE - Cixutumumab Biosimilar - Anti-IGF1 Receptor Antibody - Low endotoxin, Azide free (A323359) - Antibodies.com
(2)
A323359
Cixutumumab Biosimilar - Anti-IGF1 Receptor Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IGF1 Receptor for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Figitumumab Biosimilar - Anti-IGF1 Receptor Antibody - Low endotoxin, Azide free (A323453) - Antibodies.com
(2)
A323453
Figitumumab Biosimilar - Anti-IGF1 Receptor Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IGF1 Receptor for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Lonigutamab Biosimilar - Anti-IGF1 Receptor Antibody - Low endotoxin, Azide free (A323556) - Antibodies.com
(3)
A323556
Lonigutamab Biosimilar - Anti-IGF1 Receptor Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IGF1 Receptor for ELISA, FACS, Functional Assay and In Vivo.
Immunohistochemistry - Anti-IGF1 Receptor Antibody [IGF1R/4667] (A277659) - Antibodies.com
(5)
A277659
Anti-IGF1 Receptor Antibody [IGF1R/4667]
Mouse monoclonal [IGF1R/4667] antibody to IGF1 Receptor for Flow Cytometry and IF.
Immunohistochemistry - Anti-IGF1 Receptor Antibody [IGF1R/4667] - BSA and Azide free (A278247) - Antibodies.com
(5)
A278247
Anti-IGF1 Receptor Antibody [IGF1R/4667] - BSA and Azide free
Mouse monoclonal [IGF1R/4667] antibody to IGF1 Receptor for Flow Cytometry and IF.
Western Blot - Anti-IGF1 Receptor (phospho Tyr1161) Antibody (A16601) - Antibodies.com
A16601
Anti-IGF1 Receptor (phospho Tyr1161) Antibody
Rabbit polyclonal antibody to IGF1 Receptor (phospho Tyr1161) for WB.
ELISA - Anti-IGF-IR (phospho Tyr980) Antibody (P12-1029) - Antibodies.com
(2)
A93550
Anti-IGF-IR (phospho Tyr980) Antibody
Rabbit polyclonal antibody to IGF-IR (phospho Tyr980) for IHC and ELISA.
SDS-PAGE - Dalotuzumab Biosimilar - Anti-IGF1 Receptor Antibody - Low endotoxin, Azide free (A323380) - Antibodies.com
(2)
A323380
Dalotuzumab Biosimilar - Anti-IGF1 Receptor Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to IGF1 Receptor for ELISA, FACS, Functional Assay and In Vivo.
Western Blot - Anti-IGF1R (phospho Tyr1165 + Tyr1166) Antibody (A7115) - Antibodies.com
(3)
A94889
Anti-IGF1R (phospho Tyr1165 + Tyr1166) Antibody
Rabbit polyclonal antibody to IGF1R (phospho Tyr1165 + Tyr1166) for WB and ELISA.
SDS-PAGE - Teprotumumab Biosimilar - Anti-IGF1 Receptor Antibody - Low endotoxin, Azide free (A323774) - Antibodies.com
(4)
A323774
Teprotumumab Biosimilar - Anti-IGF1 Receptor Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IGF1 Receptor for ELISA, FACS, Functional Assay and In Vivo.
Western Blot - Anti-IGF1R Antibody (B8042) - Antibodies.com
(3)
A95858
Anti-IGF1R Antibody
Rabbit polyclonal antibody to IGF1R for WB, IHC and ELISA.
Western Blot - Anti-IGF1R Antibody (B7115) - Antibodies.com
(4)
A97471
Anti-IGF1R Antibody
Rabbit polyclonal antibody to IGF1R for WB and ELISA.
SDS-PAGE - Cixutumumab Biosimilar - Anti-IGF1 Receptor Antibody - Low endotoxin, Azide free (A323359) - Antibodies.com
(2)
A323359
Cixutumumab Biosimilar - Anti-IGF1 Receptor Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IGF1 Receptor for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Figitumumab Biosimilar - Anti-IGF1 Receptor Antibody - Low endotoxin, Azide free (A323453) - Antibodies.com
(2)
A323453
Figitumumab Biosimilar - Anti-IGF1 Receptor Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IGF1 Receptor for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Lonigutamab Biosimilar - Anti-IGF1 Receptor Antibody - Low endotoxin, Azide free (A323556) - Antibodies.com
(3)
A323556
Lonigutamab Biosimilar - Anti-IGF1 Receptor Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IGF1 Receptor for ELISA, FACS, Functional Assay and In Vivo.
Immunohistochemistry - Anti-IGF1 Receptor Antibody [IGF1R/4667] (A277659) - Antibodies.com
(5)
A277659
Anti-IGF1 Receptor Antibody [IGF1R/4667]
Mouse monoclonal [IGF1R/4667] antibody to IGF1 Receptor for Flow Cytometry and IF.
Immunohistochemistry - Anti-IGF1 Receptor Antibody [IGF1R/4667] - BSA and Azide free (A278247) - Antibodies.com
(5)
A278247
Anti-IGF1 Receptor Antibody [IGF1R/4667] - BSA and Azide free
Mouse monoclonal [IGF1R/4667] antibody to IGF1 Receptor for Flow Cytometry and IF.
Western Blot - Anti-IGF1 Receptor (phospho Tyr1161) Antibody (A16601) - Antibodies.com
A16601
Anti-IGF1 Receptor (phospho Tyr1161) Antibody
Rabbit polyclonal antibody to IGF1 Receptor (phospho Tyr1161) for WB.
ELISA - Anti-IGF-IR (phospho Tyr980) Antibody (P12-1029) - Antibodies.com
(2)
A93550
Anti-IGF-IR (phospho Tyr980) Antibody
Rabbit polyclonal antibody to IGF-IR (phospho Tyr980) for IHC and ELISA.
SDS-PAGE - Dalotuzumab Biosimilar - Anti-IGF1 Receptor Antibody - Low endotoxin, Azide free (A323380) - Antibodies.com
(2)
A323380
Dalotuzumab Biosimilar - Anti-IGF1 Receptor Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to IGF1 Receptor for ELISA, FACS, Functional Assay and In Vivo.
See all IGF1 Receptor Antibodies
Main Menu Contact Us 0Checkout
Top