+1 (314) 370-6046 or
Contact Us
Explore our End of Year Promotion >>
Antibodies.com LogoAntibodies.com Logo
Sign In / RegisterMy Account
0

Anti-ICAM1 Antibody (A9725)

Name
Anti-ICAM1 Antibody
Description
Rabbit polyclonal antibody to ICAM1.
Applications
WB, IHC, ICC/IF
Dilutions
WB: 1:1,000-1:5,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200
Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 120-320 of human ICAM-1/CD54 (NP_000192.2).
Sequence
PLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKP
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
89 kDa / 92 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
Antigen identified by monoclonal, BB 2, BB2, CD 54 , CD54, CD54 antigen , CD_antigen=CD54, Cell surface glycoprotein P3.58 , Human rhinovirus receptor , ICAM 1, ICAM-1, ICAM1_HUMAN, Intercellular adhesion molecule 1 , intercellular adhesion molecule 1 (CD54), human rhinovirus receptor, Major group rhinovirus receptor , MALA 2, MALA2 , MGC6195, MyD 10, MyD10, P3.58 , Surface antigen of activated B cells , Surface antigen of activated B cells, BB2
Isotype Controls
Suitable Secondaries
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Western Blot - Anti-ICAM1 Antibody (A9725) - Antibodies.comEnlarge Image
Figure 1: Western Blot - Anti-ICAM1 Antibody (A9725)
Western blot analysis of various lysates, using Anti-ICAM1 Antibody (A9725) at 1:3,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 0.5s.
Western Blot - Anti-ICAM1 Antibody (A9725) - Antibodies.comEnlarge Image
Figure 2: Western Blot - Anti-ICAM1 Antibody (A9725)
Western blot analysis of various lysates, using Anti-ICAM1 Antibody (A9725) at 1:3,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 0.5s.
Western Blot - Anti-ICAM1 Antibody (A9725) - Antibodies.comEnlarge Image
Figure 3: Western Blot - Anti-ICAM1 Antibody (A9725)
Western blot analysis of Mouse lung, using Anti-ICAM1 Antibody (A9725) at 1:3,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 0.5s.
Immunohistochemistry - Anti-ICAM1 Antibody (A9725) - Antibodies.comEnlarge Image
Figure 4: Immunohistochemistry - Anti-ICAM1 Antibody (A9725)
Immunohistochemistry analysis of paraffin-embedded mouse lung using Anti-ICAM1 Antibody (A9725) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Publishing research using Anti-ICAM1 Antibody (A9725)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-ICAM1 Antibody (A9725)

Western Blot - Anti-ICAM1 Antibody [MEM-111] (A85681) - Antibodies.com
A85684
19 Citations
Anti-ICAM1 Antibody [MEM-111]
Mouse monoclonal [MEM-111] antibody to ICAM1 for WB, IHC-P, ELISA, Flow Cytometry and ICC.
Western Blot - Anti-ICAM1 Antibody (A306660) - Antibodies.com
(5)
A306660
Anti-ICAM1 Antibody
Rabbit polyclonal antibody to ICAM1 for WB and IHC.
Western Blot - Anti-ICAM1 Antibody (A83533) - Antibodies.com
(4)
A83533
Anti-ICAM1 Antibody
Goat polyclonal antibody to ICAM1 for ELISA, WB, IF and Flow Cytometry.
SDS-PAGE - Anti-ICAM1 Antibody [15.2] - BSA and Azide free (A252083) - Antibodies.com
A252084
Anti-ICAM1 Antibody [15.2] - BSA and Azide free
Mouse monoclonal [152] antibody to ICAM1 for Functional Studies, Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-ICAM1 Antibody [P2A4] (A248905) - Antibodies.com
(3)
A248905
Anti-ICAM1 Antibody [P2A4]
Mouse monoclonal [P2A4] antibody to ICAM1 for Functional Studies, Flow Cytometry, IF and IHC-P.
Antibodies.com Image Placeholder - Discover more for less
A279070
Anti-ICAM1 Antibody [1A29] - BSA and Azide free
Mouse monoclonal [1A29] antibody to ICAM1 for Flow Cytometry, IF, IHC-Fr, IP, WB, IHC-P and Functional Assays.
Immunohistochemistry - Anti-ICAM1 Antibody [P2A4] - BSA and Azide free (A252085) - Antibodies.com
(3)
A252085
Anti-ICAM1 Antibody [P2A4] - BSA and Azide free
Mouse monoclonal [P2A4] antibody to ICAM1 for Functional Studies, Flow Cytometry, IF and IHC-P.
SDS-PAGE - Bersanlimab Biosimilar - Anti-ICAM1 Antibody - Low endotoxin, Azide free (A323315) - Antibodies.com
(3)
A323315
Bersanlimab Biosimilar - Anti-ICAM1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to ICAM1 for ELISA, FACS, Functional Assay and In Vivo.
Antibodies.com Image Placeholder - Discover more for less
A279533
Anti-ICAM1 Antibody [84H10]
Mouse monoclonal [84H10] antibody to ICAM1 for ELISA, Functional Assays, Flow Cytometry, IHC-Fr and IP.
Western Blot - Anti-ICAM-1 (phospho Tyr512) Antibody (A7113) - Antibodies.com
(2)
A95508
Anti-ICAM-1 (phospho Tyr512) Antibody
Rabbit polyclonal antibody to ICAM-1 (phospho Tyr512) for WB and ELISA.
Antibodies.com Image Placeholder - Discover more for less
A278718
Anti-ICAM1 Antibody [15.2] - BSA and Azide free
Mouse monoclonal [152] antibody to ICAM1 for Flow Cytometry, IHC-Fr, IHC-P, IP and Functional Assays.
SDS-PAGE - Anti-ICAM1 Antibody [W-CAM-1] (A248902) - Antibodies.com
(2)
A248902
Anti-ICAM1 Antibody [W-CAM-1]
Mouse monoclonal [W-CAM-1] antibody to ICAM1 for Functional Studies, Flow Cytometry and IHC-P.
Western Blot - Anti-ICAM1 Antibody [MEM-111] (A85681) - Antibodies.com
A85684
19 Citations
Anti-ICAM1 Antibody [MEM-111]
Mouse monoclonal [MEM-111] antibody to ICAM1 for WB, IHC-P, ELISA, Flow Cytometry and ICC.
Western Blot - Anti-ICAM1 Antibody (A306660) - Antibodies.com
(5)
A306660
Anti-ICAM1 Antibody
Rabbit polyclonal antibody to ICAM1 for WB and IHC.
Western Blot - Anti-ICAM1 Antibody (A83533) - Antibodies.com
(4)
A83533
Anti-ICAM1 Antibody
Goat polyclonal antibody to ICAM1 for ELISA, WB, IF and Flow Cytometry.
SDS-PAGE - Anti-ICAM1 Antibody [15.2] - BSA and Azide free (A252083) - Antibodies.com
A252084
Anti-ICAM1 Antibody [15.2] - BSA and Azide free
Mouse monoclonal [152] antibody to ICAM1 for Functional Studies, Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-ICAM1 Antibody [P2A4] (A248905) - Antibodies.com
(3)
A248905
Anti-ICAM1 Antibody [P2A4]
Mouse monoclonal [P2A4] antibody to ICAM1 for Functional Studies, Flow Cytometry, IF and IHC-P.
Antibodies.com Image Placeholder - Discover more for less
A279070
Anti-ICAM1 Antibody [1A29] - BSA and Azide free
Mouse monoclonal [1A29] antibody to ICAM1 for Flow Cytometry, IF, IHC-Fr, IP, WB, IHC-P and Functional Assays.
Immunohistochemistry - Anti-ICAM1 Antibody [P2A4] - BSA and Azide free (A252085) - Antibodies.com
(3)
A252085
Anti-ICAM1 Antibody [P2A4] - BSA and Azide free
Mouse monoclonal [P2A4] antibody to ICAM1 for Functional Studies, Flow Cytometry, IF and IHC-P.
SDS-PAGE - Bersanlimab Biosimilar - Anti-ICAM1 Antibody - Low endotoxin, Azide free (A323315) - Antibodies.com
(3)
A323315
Bersanlimab Biosimilar - Anti-ICAM1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to ICAM1 for ELISA, FACS, Functional Assay and In Vivo.
Antibodies.com Image Placeholder - Discover more for less
A279533
Anti-ICAM1 Antibody [84H10]
Mouse monoclonal [84H10] antibody to ICAM1 for ELISA, Functional Assays, Flow Cytometry, IHC-Fr and IP.
Western Blot - Anti-ICAM-1 (phospho Tyr512) Antibody (A7113) - Antibodies.com
(2)
A95508
Anti-ICAM-1 (phospho Tyr512) Antibody
Rabbit polyclonal antibody to ICAM-1 (phospho Tyr512) for WB and ELISA.
Antibodies.com Image Placeholder - Discover more for less
A278718
Anti-ICAM1 Antibody [15.2] - BSA and Azide free
Mouse monoclonal [152] antibody to ICAM1 for Flow Cytometry, IHC-Fr, IHC-P, IP and Functional Assays.
SDS-PAGE - Anti-ICAM1 Antibody [W-CAM-1] (A248902) - Antibodies.com
(2)
A248902
Anti-ICAM1 Antibody [W-CAM-1]
Mouse monoclonal [W-CAM-1] antibody to ICAM1 for Functional Studies, Flow Cytometry and IHC-P.
See all ICAM1 Antibodies
Main Menu Contact Us 0Checkout
Top