Anti-HtrA2 / Omi Antibody [ARC0864] (A306140)

Anti-HtrA2 / Omi Antibody [ARC0864]

Rabbit monoclonal [ARC0864] antibody to HtrA2 / Omi.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HTRA2 (O43464).

GTRSRAWLAVALGAGGAVLLLLWGGGRGPPAVLAAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVV

Rabbit

Monoclonal

ARC0864

IgG

Affinity purification.

36 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

High temperature requirement protein A2, HTRA 2, HtrA like serine protease, HtrA serine peptidase 2, HtrA, E. coli, homolog of, 2, HtrA2, HTRA2_HUMAN, mitochondrial, Omi stress regulated endoprotease, Omi stress-regulated endoprotease, PARK 13, PARK13, Protease serine 25, PRSS 25, PRSS25, Serine protease 25, Serine protease HTRA2, Serine protease HTRA2 mitochondrial, Serine protease htra2 mitochondrial precursor, Serine protease omi, Serine proteinase OMI