Anti-HLTF Antibody [ARC1982] (A308870)

Anti-HLTF Antibody [ARC1982]

Rabbit monoclonal [ARC1982] antibody to HLTF.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 900-1009 of human HLTF (Q14527).

TEAGSPTIMLLSLKAGGVGLNLSAASRVFLMDPAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAKINEIRTLIDL

Rabbit

Monoclonal

ARC1982

IgG

Unconjugated

114 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

DNA-binding protein/plasminogen activator inhibitor 1 regulator, Helicase like transcription factor, Helicase-like transcription factor, HIP116, HIP116A, HLTF 1, HLTF1, HLTF_HUMAN, p113, RING finger protein 80, RNF80, SMARC A3, SMARCA 3, SMARCA3, SNF2-like 3, SNF2L3, Sucrose nonfermenting protein 2 like 3, Sucrose nonfermenting protein 2-like 3, SWI/SNF related matrix associated actin dependent regulator of chromatin subfamily A member 3, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a3, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3, ZBU 1, ZBU1