Anti-HLA-G Antibody (A10165)

Anti-HLA-G Antibody

Rabbit polyclonal antibody to HLA-G.

WB: 1:500-1:2000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 20-230 of human HLA-G (NP_002118.1).

TETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWAL

Rabbit

Polyclonal

IgG

Affinity purification.

43kDa

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

B2 microglobulin, DADB-15K14.8, HLA 6.0, HLA class I histocompatibility antigen alpha chain G, HLA class I histocompatibility antigen, alpha chain G, HLA class I molecule, HLA G, HLA G antigen, HLA G histocompatibility antigen class I G, HLA G3, HLA-G histocompatibility antigen, class I, HLA60, HLAG, HLAG_HUMAN, Major histocompatibility complex class I G, MHC class I antigen, MHC class I antigen G, MHC G, T-cell A locus, TCA