Anti-Histone H4 Antibody [ARC2340] (A308423)

Rabbit monoclonal [ARC2340] antibody to Histone H4 for WB and IHC.

Freight Charges
Lead Time
5-8 Business Days
Telephone
+1 (314) 370-6046
Mon - Fri, 8am - 4pm AST
Email
orders@antibodies.com
Name
Anti-Histone H4 Antibody [ARC2340]
Description
Rabbit monoclonal [ARC2340] antibody to Histone H4.
Applications
WB, IHC
Dilutions
WB: 1:500-1:1,000, IHC: 1:50-1:200
Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 24-103 of human Histone H4 (P62805).
Sequence
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Host
Rabbit
Clonality
Monoclonal
Clone ID
ARC2340
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
11 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
dJ160A22.1, dJ160A22.2, dJ221C16.1, dJ221C16.9, FO108, H4, H4 histone family, member A, H4 histone family, member B, H4 histone family, member C, H4 histone family, member D, H4 histone family, member E, H4 histone family, member G, H4 histone family, member H, H4 histone family, member I, H4 histone family, member J, H4 histone family, member K, H4 histone family, member M, H4 histone family, member N, H4 histone, family 2, H4.k, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/N, H4/O, H4/p, H4D, H4F2, H4F2iii, H4F2iv, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FN, H4L, H4M, H4_HUMAN, HIST, HIST1 cluster, H4A, HIST1 cluster, H4B, HIST1 cluster, H4C, HIST1 cluster, H4D, HIST1 cluster, H4F, HIST1 cluster, H4H, HIST1 cluster, H4J, HIST1 CLUSTER, H4K, HIST1 CLUSTER, H4L, HIST1H4, HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, HIST1H4E, HIST1H4F, HIST1H4H, HIST1H4I, HIST1H4J, HIST1H4K, HIST1H4L, HIST2 cluster, H4A, HIST2H4, HIST2H4A, Hist4 cluster, H4, Hist4h4, HISTH4H4, Histone 1 H4a, Histone 1 H4b, Histone 1 H4c, Histone 1 H4d, Histone 1 H4e, Histone 1 H4f, Histone 1 H4h, Histone 1 H4i, Histone 1 H4j, Histone 1 H4k, Histone 1 H4l, histone 1, H4a, histone 1, H4b, histone 1, H4c, histone 1, H4d, histone 1, H4e, histone 1, H4f, histone 1, H4h, histone 1, H4i, histone 1, H4j, histone 1, H4k, histone 1, H4l, Histone 2 H4a, histone 2, H4a, histone 2, H4b, Histone 4 family, member M, histone 4 H4, histone 4, H4, histone cluster 1, H4, histone cluster 1, H4a, histone cluster 1, H4b, histone cluster 1, H4c, histone cluster 1, H4d, histone cluster 1, H4e, histone cluster 1, H4f, histone cluster 1, H4h, histone cluster 1, H4i, histone cluster 1, H4j, histone cluster 1, H4k, histone cluster 1, H4l, histone cluster 2, H4a, histone cluster 2, H4b, histone cluster 4, H4, histone family member, Histone family, member A, Histone family, member B, Histone family, member D, Histone family, member H, Histone family, member I, Histone family, member L, Histone gene cluster 1, H4, Histone gene cluster 1, H4 histone family, member A, Histone gene cluster 1, H4 histone family, member A - Histone gene cluster 1, H4 histone family, member C, Histone gene cluster 1, H4 histone family, member B, Histone gene cluster 1, H4 histone family, member C, Histone gene cluster 1, H4 histone family, member D, Histone gene cluster 1, H4 histone family, member E, Histone gene cluster 1, H4 histone family, member F, Histone gene cluster 1, H4 histone family, member H, Histone gene cluster 1, H4 histone family, member I, Histone gene cluster 1, H4 histone family, member J, Histone gene cluster 1, H4 histone family, member K, Histone gene cluster 1, H4 histone family, member L, Histone gene cluster 1, H4A, Histone gene cluster 1, H4B, Histone gene cluster 1, H4C, Histone gene cluster 1, H4D, Histone gene cluster 1, H4E, Histone gene cluster 1, H4F, Histone gene cluster 1, H4I, Histone gene cluster 1, H4J, Histone gene cluster 1, H4K, Histone gene cluster 1, H4KJ, Histone gene cluster 2, H4, Histone gene cluster 2, H4 histone family, member A, Histone gene cluster 2, H4A, Histone gene cluster 4, H4, Histone gene cluster 4, H4 histone, histone IV, family 2, methyl histone H4, methylated histone H4, MGC24116
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Publishing research using Anti-Histone H4 Antibody [ARC2340] (A308423)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-Histone H4 Antibody [ARC2340] (A308423)

Top