Anti-Histone H4 Antibody (A13282)

Rabbit polyclonal antibody to Histone H4 for WB.

Freight Charges
Lead Time
5-8 Business Days
Telephone
+1 (314) 370-6046
Mon - Fri, 8am - 4pm AST
Email
orders@antibodies.com
Name
Anti-Histone H4 Antibody
Description
Rabbit polyclonal antibody to Histone H4.
Applications
WB
Dilutions
WB: 1:500-1:1,000
Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 40-100 of human Histone H4 (NP_003529.1).
Sequence
RRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
11 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
dJ160A22.1, dJ160A22.2, dJ221C16.1, dJ221C16.9, FO108, H4, H4 histone family, member A, H4 histone family, member B, H4 histone family, member C, H4 histone family, member D, H4 histone family, member E, H4 histone family, member G, H4 histone family, member H, H4 histone family, member I, H4 histone family, member J, H4 histone family, member K, H4 histone family, member M, H4 histone family, member N, H4 histone, family 2, H4.k, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/N, H4/O, H4/p, H4D, H4F2, H4F2iii, H4F2iv, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FN, H4L, H4M, H4_HUMAN, HIST, HIST1 cluster, H4A, HIST1 cluster, H4B, HIST1 cluster, H4C, HIST1 cluster, H4D, HIST1 cluster, H4F, HIST1 cluster, H4H, HIST1 cluster, H4J, HIST1 CLUSTER, H4K, HIST1 CLUSTER, H4L, HIST1H4, HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, HIST1H4E, HIST1H4F, HIST1H4H, HIST1H4I, HIST1H4J, HIST1H4K, HIST1H4L, HIST2 cluster, H4A, HIST2H4, HIST2H4A, Hist4 cluster, H4, Hist4h4, HISTH4H4, Histone 1 H4a, Histone 1 H4b, Histone 1 H4c, Histone 1 H4d, Histone 1 H4e, Histone 1 H4f, Histone 1 H4h, Histone 1 H4i, Histone 1 H4j, Histone 1 H4k, Histone 1 H4l, histone 1, H4a, histone 1, H4b, histone 1, H4c, histone 1, H4d, histone 1, H4e, histone 1, H4f, histone 1, H4h, histone 1, H4i, histone 1, H4j, histone 1, H4k, histone 1, H4l, Histone 2 H4a, histone 2, H4a, histone 2, H4b, Histone 4 family, member M, histone 4 H4, histone 4, H4, histone cluster 1, H4, histone cluster 1, H4a, histone cluster 1, H4b, histone cluster 1, H4c, histone cluster 1, H4d, histone cluster 1, H4e, histone cluster 1, H4f, histone cluster 1, H4h, histone cluster 1, H4i, histone cluster 1, H4j, histone cluster 1, H4k, histone cluster 1, H4l, histone cluster 2, H4a, histone cluster 2, H4b, histone cluster 4, H4, histone family member, Histone family, member A, Histone family, member B, Histone family, member D, Histone family, member H, Histone family, member I, Histone family, member L, Histone gene cluster 1, H4, Histone gene cluster 1, H4 histone family, member A, Histone gene cluster 1, H4 histone family, member A - Histone gene cluster 1, H4 histone family, member C, Histone gene cluster 1, H4 histone family, member B, Histone gene cluster 1, H4 histone family, member C, Histone gene cluster 1, H4 histone family, member D, Histone gene cluster 1, H4 histone family, member E, Histone gene cluster 1, H4 histone family, member F, Histone gene cluster 1, H4 histone family, member H, Histone gene cluster 1, H4 histone family, member I, Histone gene cluster 1, H4 histone family, member J, Histone gene cluster 1, H4 histone family, member K, Histone gene cluster 1, H4 histone family, member L, Histone gene cluster 1, H4A, Histone gene cluster 1, H4B, Histone gene cluster 1, H4C, Histone gene cluster 1, H4D, Histone gene cluster 1, H4E, Histone gene cluster 1, H4F, Histone gene cluster 1, H4I, Histone gene cluster 1, H4J, Histone gene cluster 1, H4K, Histone gene cluster 1, H4KJ, Histone gene cluster 2, H4, Histone gene cluster 2, H4 histone family, member A, Histone gene cluster 2, H4A, Histone gene cluster 4, H4, Histone gene cluster 4, H4 histone, histone IV, family 2, methyl histone H4, methylated histone H4, MGC24116
Publishing research using Anti-Histone H4 Antibody (A13282)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-Histone H4 Antibody (A13282)

Top