Anti-Histone H3 Antibody (A88523)

Rabbit polyclonal antibody to Histone H3 for WB, IHC, IP and ChIP.

Freight Charges
Lead Time
5-8 Business Days
Telephone
+1 (314) 370-6046
Mon - Fri, 8am - 4pm AST
Email
orders@antibodies.com

Highlighted products for Anti-Histone H3 Antibody

Name
Anti-Histone H3 Antibody
Description
Rabbit polyclonal antibody to Histone H3.
Applications
WB, IHC, IP, ChIP
Dilutions
WB: 1:2,000-1:10,000, IHC: 1:50-1:200, IP: 1:50-1:200, ChIP: 1:50-1:200
Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human HIST3H3 (NP_003484.1).
Sequence
REIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
17 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
Cit Histone H3, Citrullated, citrullin, Citrullinated Histone H3, citrulline, FLJ92264, H 3, H3, H3 3 like sequence MH921, H3 3A, H3 a, H3 b, H3 c, H3 d, H3 f, H3 h, H3 histone, H3 histone family member E pseudogene, H3 histone family, member A, H3 histone family, member B, H3 histone family, member C, H3 histone family, member D, H3 histone family, member F, H3 histone family, member H, H3 histone family, member I, H3 histone family, member J, H3 histone family, member K, H3 histone family, member L, H3 histone family, member T, H3 histone, family 3A, H3 i, H3 j, H3 k, H3 l, H3.1, H3.3A, H3/A, H3/b, H3/c, H3/d, h3/f, H3/h, H3/i, H3/j, H3/k, H3/l, H3/t, H31_HUMAN, H33_HUMAN, H3F1K, H3F3, H3F3A, H3f3b, H3FA, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, HIST1 cluster, H3A, HIST1 cluster, H3B, HIST1 cluster, H3C, HIST1 cluster, H3D, HIST1 cluster, H3E, HIST1 cluster, H3F, HIST1 cluster, H3G, HIST1 cluster, H3H, HIST1 cluster, H3I, HIST1 cluster, H3J, Hist1h3a, HIST1H3B, HIST1H3C, HIST1H3D, HIST1H3E, HIST1H3F, HIST1H3G, HIST1H3H, HIST1H3I, HIST1H3J, HIST3H3, HIST3HA, histone 1, H3a, Histone 1, H3b, Histone 1, H3c, Histone 1, H3d, Histone 1, H3e, Histone 1, H3f, Histone 1, H3g, Histone 1, H3h, Histone 1, H3i, Histone 1, H3j, Histone 3, H3, histone cluster 1 H3 family member a, histone cluster 1 H3 family member b, histone cluster 1 H3 family member c, histone cluster 1 H3 family member d, histone cluster 1 H3 family member e, histone cluster 1 H3 family member f, histone cluster 1 H3 family member g, histone cluster 1 H3 family member h, histone cluster 1 H3 family member i, histone cluster 1 H3 family member j, Histone cluster 1, H3a, Histone cluster 1, H3b, Histone cluster 1, H3c, Histone cluster 1, H3d, Histone cluster 1, H3e, Histone cluster 1, H3f, Histone cluster 1, H3g, Histone cluster 1, H3i, Histone cluster 1, H3j, Histone gene cluster 1, H3 histone family, member A, Histone gene cluster 1, H3 histone family, member B, Histone gene cluster 1, H3 histone family, member C, Histone gene cluster 1, H3 histone family, member D, Histone gene cluster 1, H3 histone family, member E, Histone gene cluster 1, H3 histone family, member F, Histone gene cluster 1, H3 histone family, member G, Histone gene cluster 1, H3 histone family, member H, Histone gene cluster 1, H3 histone family, member I, Histone gene cluster 1, H3 histone family, member J, Histone gene cluster 1, H3A, Histone gene cluster 1, H3B, Histone gene cluster 1, H3C, Histone gene cluster 1, H3D, Histone gene cluster 1, H3E, Histone gene cluster 1, H3F, Histone gene cluster 1, H3G, Histone gene cluster 1, H3H, Histone gene cluster 1, H3I, Histone gene cluster 1, H3J, Histone H 3, Histone H3 3 pseudogene, Histone H3 Citrullated, Histone H3.1, Histone H3.1t, Histone H3.2, Histone H3.3, Histone H3.3C, Histone H3.5, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/i, Histone H3/j, Histone H3/k, Histone H3/l, Histone H3/m, Histone H3/o
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Publishing research using Anti-Histone H3 Antibody (A88523)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-Histone H3 Antibody (A88523)

Top