Anti-Histone H1.4 Antibody (A307751)

Anti-Histone H1.4 Antibody

Rabbit polyclonal antibody to Histone H1.4.

WB: 1:500-1:1,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H14 (NP_005312.1).

MSETAPAAPAAPAPAEKTPVKKKARKSAGAAKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTG

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

dJ221C16.2, dJ221C16.5, DmeH1, H1, H1 0 histone, H1 histone family, H1 histone family member 0, H1 histone family member 1, H1 histone family member 3, H1 histone family member 5, H1 histone family member N testis specific, H1 histone family member O oocyte specific, H1 histone family member X, H1(0), H1.1, H1.2, H1.3, H1.4, H1.5, H10, H14_HUMAN, H1A, H1f0, H1F0 protein, H1F1, H1F2, H1F3, H1F4, H1F5, H1FNT, H1FOO, H1FOO protein, H1FOO_HUMAN, H1FT, H1FV, H1FX, H1oo, H1t, H1T2, H1X, HANP1, His1, HisC, HIST1, HIST1H1A, HIST1H1B, HIST1H1C, HIST1H1D, HIST1H1E, HIST1H1T, Histone, Histone 1 H1a, Histone 1 H1b, Histone 1 H1c, Histone 1 H1d, Histone 1 H1e, Histone 1 H1t, Histone H1, Histone H1', Histone H1.0, Histone H1.1, Histone H1.2, Histone H1.3, Histone H1.5, Histone H1a, Histone H1B, Histone H1oo, Histone H1x, MGC116819, MGC126630, MGC126632, MGC126642, MGC138176, MGC138345, MGC15959, MGC3992, MGC50807, MGC5241, MGC8350, Oocyte specific histone H1, Oocyte specific linker histone H1, Oocyte-specific histone H1, Oocyte-specific linker histone H1, osH1, Testicular H1 histone