Anti-GRIM19 Antibody (A14745)

Anti-GRIM19 Antibody

Rabbit polyclonal antibody to GRIM19.

WB: 1:500-1:1,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human NDUFA13/GRIM19 (NP_057049.5).

MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT

Rabbit

Polyclonal

IgG

Unconjugated

17 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

2700054G14Rik, AU022060, B16.6, CDA016, Cell death regulatory protein, Cell death regulatory protein GRIM-19, CGI-39, CGI39 protein, CI-B16.6, Complex I-B16.6, FLJ58045, FLJ59191, Gene associated with retinoic and IFN-induced mortality 19 protein, Gene associated with retinoic and interferon-induced mortality 19 protein, Gene associated with retinoic interferon induced mortality 19 protein, GRIM-19, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13, NADH ubiquinone oxidoreductase B16.6 subunit, NADH-ubiquinone oxidoreductase B16.6 subunit, NDUAD_HUMAN, NDUFA13, RGD1565358