+1 (314) 370-6046 or
Contact Us
Explore our End of Year Promotion >>
Antibodies.com LogoAntibodies.com Logo
Sign In / RegisterMy Account
0

Anti-GM-CSF Antibody (A11919)

Western Blot - Anti-GM-CSF Antibody (A11919) - Antibodies.com Immunofluorescence - Anti-GM-CSF Antibody (A11919) - Antibodies.com Immunofluorescence - Anti-GM-CSF Antibody (A11919) - Antibodies.com Immunofluorescence - Anti-GM-CSF Antibody (A11919) - Antibodies.com
$335
Product Datasheet

Rabbit polyclonal antibody to GM-CSF for WB and ICC/IF.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Freight Charges
$40 to United States
Lead Time
5-8 Business Days

Telephone
+1 (314) 370-6046
Mon - Fri, 8am - 4pm AST
Email
orders@antibodies.com

Name
Anti-GM-CSF Antibody
Description
Rabbit polyclonal antibody to GM-CSF.
Applications
WB, ICC/IF
Dilutions
WB: 1:500-1:2,000, ICC/IF: 1:50-1:200
Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CSF2 (NP_000749.2).
Sequence
MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASH
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
16 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
Colony stimulating factor, Colony Stimulating Factor 2, Colony stimulating factor 2 (granulocyte-macrophage), Colony-stimulating factor, CSF, CSF 2, CSF2, CSF2_HUMAN, GMCSF, Granulocyte Macrophage Colony Stimulating Factor, Granulocyte-macrophage colony-stimulating factor, MGC131935, MGC138897, MGI1GM, Molgramostin, Pluripoietin-a, Sargramostim
Isotype Controls
Suitable Secondaries
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Western Blot - Anti-GM-CSF Antibody (A11919) - Antibodies.comEnlarge Image
Figure 1: Western Blot - Anti-GM-CSF Antibody (A11919)
Western blot analysis of extracts of various cell lines, using Anti-GM-CSF Antibody (A11919) at 1:500 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 120s.
Immunofluorescence - Anti-GM-CSF Antibody (A11919) - Antibodies.comEnlarge Image
Figure 2: Immunofluorescence - Anti-GM-CSF Antibody (A11919)
Immunofluorescence analysis of C6 cells using Anti-GM-CSF Antibody (A11919) at a dilution of 1:100. DAPI was used to stain the cell nuclei (blue).
Immunofluorescence - Anti-GM-CSF Antibody (A11919) - Antibodies.comEnlarge Image
Figure 3: Immunofluorescence - Anti-GM-CSF Antibody (A11919)
Immunofluorescence analysis of L929 cells using Anti-GM-CSF Antibody (A11919) at a dilution of 1:100. DAPI was used to stain the cell nuclei (blue).
Immunofluorescence - Anti-GM-CSF Antibody (A11919) - Antibodies.comEnlarge Image
Figure 4: Immunofluorescence - Anti-GM-CSF Antibody (A11919)
Immunofluorescence analysis of U-2 OS cells using Anti-GM-CSF Antibody (A11919) at a dilution of 1:100. DAPI was used to stain the cell nuclei (blue).
Publishing research using Anti-GM-CSF Antibody (A11919)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-GM-CSF Antibody (A11919)

SDS-PAGE - Anti-GM-CSF Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free (A324043) - Antibodies.com
(4)
A324043
Anti-GM-CSF Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free
Recombinant human monoclonal antibody to GM-CSF for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Namilumab Biosimilar - Anti-GM-CSF Antibody - Low endotoxin, Azide free (A323594) - Antibodies.com
(3)
A323594
Namilumab Biosimilar - Anti-GM-CSF Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to GM-CSF for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Otilimab Biosimilar - Anti-GM-CSF Antibody - Low endotoxin, Azide free (A323641) - Antibodies.com
(4)
A323641
Otilimab Biosimilar - Anti-GM-CSF Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to GM-CSF for ELISA, FACS, Kinetics (BLI), Kinetics (SPR) and Functional Assay.
SDS-PAGE - Anti-GM-CSF Antibody [BVD2-21C11] (A248272) - Antibodies.com
A248273
Anti-GM-CSF Antibody [BVD2-21C11]
Rat monoclonal [BVD2-21C11] antibody to GM-CSF for Neutralization Studies, IP, Flow Cytometry, IF, WB and IHC-Fr.
SDS-PAGE - Anti-GM-CSF Antibody [BVD2-21C11] - BSA and Azide free (A251454) - Antibodies.com
A251455
Anti-GM-CSF Antibody [BVD2-21C11] - BSA and Azide free
Rat monoclonal [BVD2-21C11] antibody to GM-CSF for Neutralization Studies, IP, Flow Cytometry, IF, WB and IHC-Fr.
SDS-PAGE - Gimsilumab Biosimilar - Anti-GM-CSF Antibody - Low endotoxin, Azide free (A323480) - Antibodies.com
(4)
A323480
Gimsilumab Biosimilar - Anti-GM-CSF Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to GM-CSF for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Plonmarlimab Biosimilar - Anti-GM-CSF Antibody - Low endotoxin, Azide free (A323669) - Antibodies.com
(4)
A323669
Plonmarlimab Biosimilar - Anti-GM-CSF Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to GM-CSF for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Lenzilumab Biosimilar - Anti-GM-CSF Antibody - Low endotoxin, Azide free (A323538) - Antibodies.com
(3)
A323538
Lenzilumab Biosimilar - Anti-GM-CSF Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to GM-CSF for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-GM-CSF Antibody [CSF2/3403] (A248272) - Antibodies.com
(5)
A248272
Anti-GM-CSF Antibody [CSF2/3403]
Mouse monoclonal [CSF2/3403] antibody to GM-CSF for IHC-P.
SDS-PAGE - Anti-GM-CSF Antibody [CSF2/3403] - BSA and Azide free (A251454) - Antibodies.com
(5)
A251454
Anti-GM-CSF Antibody [CSF2/3403] - BSA and Azide free
Mouse monoclonal [CSF2/3403] antibody to GM-CSF for IHC-P.
Antibodies.com Image Placeholder - Discover more for less
A251456
Anti-GM-CSF Antibody [SPM469] - BSA and Azide free
Rat monoclonal [SPM469] antibody to GM-CSF for Neutralization Studies, Flow Cytometry and IF.
Antibodies.com Image Placeholder - Discover more for less
A248274
Anti-GM-CSF Antibody [SPM469]
Rat monoclonal [SPM469] antibody to GM-CSF for Neutralization Studies, Flow Cytometry and IF.
SDS-PAGE - Anti-GM-CSF Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free (A324043) - Antibodies.com
(4)
A324043
Anti-GM-CSF Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free
Recombinant human monoclonal antibody to GM-CSF for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Namilumab Biosimilar - Anti-GM-CSF Antibody - Low endotoxin, Azide free (A323594) - Antibodies.com
(3)
A323594
Namilumab Biosimilar - Anti-GM-CSF Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to GM-CSF for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Otilimab Biosimilar - Anti-GM-CSF Antibody - Low endotoxin, Azide free (A323641) - Antibodies.com
(4)
A323641
Otilimab Biosimilar - Anti-GM-CSF Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to GM-CSF for ELISA, FACS, Kinetics (BLI), Kinetics (SPR) and Functional Assay.
SDS-PAGE - Anti-GM-CSF Antibody [BVD2-21C11] (A248272) - Antibodies.com
A248273
Anti-GM-CSF Antibody [BVD2-21C11]
Rat monoclonal [BVD2-21C11] antibody to GM-CSF for Neutralization Studies, IP, Flow Cytometry, IF, WB and IHC-Fr.
SDS-PAGE - Anti-GM-CSF Antibody [BVD2-21C11] - BSA and Azide free (A251454) - Antibodies.com
A251455
Anti-GM-CSF Antibody [BVD2-21C11] - BSA and Azide free
Rat monoclonal [BVD2-21C11] antibody to GM-CSF for Neutralization Studies, IP, Flow Cytometry, IF, WB and IHC-Fr.
SDS-PAGE - Gimsilumab Biosimilar - Anti-GM-CSF Antibody - Low endotoxin, Azide free (A323480) - Antibodies.com
(4)
A323480
Gimsilumab Biosimilar - Anti-GM-CSF Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to GM-CSF for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Plonmarlimab Biosimilar - Anti-GM-CSF Antibody - Low endotoxin, Azide free (A323669) - Antibodies.com
(4)
A323669
Plonmarlimab Biosimilar - Anti-GM-CSF Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to GM-CSF for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Lenzilumab Biosimilar - Anti-GM-CSF Antibody - Low endotoxin, Azide free (A323538) - Antibodies.com
(3)
A323538
Lenzilumab Biosimilar - Anti-GM-CSF Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to GM-CSF for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-GM-CSF Antibody [CSF2/3403] (A248272) - Antibodies.com
(5)
A248272
Anti-GM-CSF Antibody [CSF2/3403]
Mouse monoclonal [CSF2/3403] antibody to GM-CSF for IHC-P.
SDS-PAGE - Anti-GM-CSF Antibody [CSF2/3403] - BSA and Azide free (A251454) - Antibodies.com
(5)
A251454
Anti-GM-CSF Antibody [CSF2/3403] - BSA and Azide free
Mouse monoclonal [CSF2/3403] antibody to GM-CSF for IHC-P.
Antibodies.com Image Placeholder - Discover more for less
A251456
Anti-GM-CSF Antibody [SPM469] - BSA and Azide free
Rat monoclonal [SPM469] antibody to GM-CSF for Neutralization Studies, Flow Cytometry and IF.
Antibodies.com Image Placeholder - Discover more for less
A248274
Anti-GM-CSF Antibody [SPM469]
Rat monoclonal [SPM469] antibody to GM-CSF for Neutralization Studies, Flow Cytometry and IF.
See all GM-CSF Antibodies
Main Menu Contact Us 0Checkout
Top