Anti-GAB2 Antibody (A91097)

Anti-GAB2 Antibody

Rabbit polyclonal antibody to GAB2.

WB: 1:500-1:2,000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 377-676 of human GAB2 (NP_536739.1).

ENSRSVAATIPRRNTLPAMDNSRLHRASSCETYEYPQRGGESAGRSAESMSDGVGSFLPGKMIVGRSDSTNSEDNYVPMNPGSSTLLAMERAGDNSQSVYIPMSPGAHHFDSLGYPSTTLPVHRGPSRGSEIQPPPVNRNLKPDRKAKPTPLDLRNNTVIDELPFKSPITKSWSRANHTFNSSSSQYCRPISTQSITSTDSGDSEENYVPMQNPVSASPVPSGTNSPAPKKSTGSVDYLALDFQPSSPSPHRKPSTSSVTSDEKVDYVQVDKEKTQALQNTMQEWTDVRQSSEPSKGAKL

Rabbit

Polyclonal

IgG

Unconjugated

74 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

GAB 2, GAB2_HUMAN, Grb 2 associated binder 2, GRB 2 associated binding protein 2, Grb2 associated binder 2, GRB2 associated binder 2 pp100, GRB2 associated binding protein 2, GRB2-associated binder 2, GRB2-associated-binding protein 2, Growth factor receptor bound protein 2 associated protein 2, Growth factor receptor bound protein 2-associated protein 2, KIAA0571, p97, PH domain containing adaptor molecule p97, pp100