+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
Antibodies.com Logo Antibodies.com Logo
Sign In/Register
0

Anti-VEGF Receptor 1 Antibody (A17185)

Western Blot - Anti-VEGF Receptor 1 Antibody (A17185) - Antibodies.com Immunohistochemistry - Anti-VEGF Receptor 1 Antibody (A17185) - Antibodies.com Immunohistochemistry - Anti-VEGF Receptor 1 Antibody (A17185) - Antibodies.com Immunohistochemistry - Anti-VEGF Receptor 1 Antibody (A17185) - Antibodies.com
$355
Product Datasheet

Rabbit polyclonal antibody to VEGF Receptor 1 for WB and IHC.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 7-10 business days.

  • Specifications

Name
Anti-VEGF Receptor 1 Antibody
Description
Rabbit polyclonal antibody to VEGF Receptor 1.
Applications
WB, IHC
Dilutions
WB: 1:500-1:2,000, IHC: 1:50-1:100
Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 20-300 of human VEGFR1 (NP_001153392.1).
Sequence
LTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Concentration
Lot Specific
Molecular Weight
151 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles.
Synonyms
FLT, FLT-1, FLT1, Fms-like tyrosine kinase 1, FRT, Tyrosine-protein kinase FRT, Tyrosine-protein kinase receptor FLT, Vascular endothelial growth factor receptor 1, Vascular permeability factor receptor, VEGFR-1, VEGFR1
Isotype Controls
Suitable Secondaries
See all Anti-Rabbit IgG Secondaries →
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.

  • Scientific Validation DataValidation Data (4)

Western Blot - Anti-VEGF Receptor 1 Antibody (A17185) - Antibodies.comEnlarge Image

Western Blot - Anti-VEGF Receptor 1 Antibody (A17185)

Western blot analysis of extracts of various cell lines, using Anti-VEGF Receptor 1 Antibody (A17185) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Enhanced Kit (RM00021). Exposure time: 30s.
Immunohistochemistry - Anti-VEGF Receptor 1 Antibody (A17185) - Antibodies.comEnlarge Image

Immunohistochemistry - Anti-VEGF Receptor 1 Antibody (A17185)

Immunohistochemistry analysis of paraffin-embedded rat spleen using Anti-VEGF Receptor 1 Antibody (A17185) at a dilution of 1:100 (40x lens).
Immunohistochemistry - Anti-VEGF Receptor 1 Antibody (A17185) - Antibodies.comEnlarge Image

Immunohistochemistry - Anti-VEGF Receptor 1 Antibody (A17185)

Immunohistochemistry analysis of paraffin-embedded human placenta using Anti-VEGF Receptor 1 Antibody (A17185) at a dilution of 1:100 (40x lens).
Immunohistochemistry - Anti-VEGF Receptor 1 Antibody (A17185) - Antibodies.comEnlarge Image

Immunohistochemistry - Anti-VEGF Receptor 1 Antibody (A17185)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using Anti-VEGF Receptor 1 Antibody (A17185) at a dilution of 1:100 (40x lens).
Publishing research using Anti-VEGF Receptor 1 Antibody (A17185)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-VEGF Receptor 1 Antibody (A17185)

Western Blot - Anti-VEGF Receptor 1 Antibody (A12509) - Antibodies.com
(3)
A12509
Anti-VEGF Receptor 1 Antibody
Rabbit polyclonal antibody to VEGF Receptor 1 for WB and ICC/IF.
SDS-PAGE - Anti-VEGF Receptor 1 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free (A324288) - Antibodies.com
(2)
A324288
Anti-VEGF Receptor 1 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free
Recombinant human monoclonal antibody to VEGF Receptor 1 for ELISA, FACS, Functional Assay and In Vivo.
Western Blot - Anti-VEGF Receptor 1 Antibody [ARC0363] (A307992) - Antibodies.com
(2)
A307992
Anti-VEGF Receptor 1 Antibody [ARC0363]
Rabbit monoclonal [ARC0363] antibody to VEGF Receptor 1 for WB.
ELISA - Icrucumab Biosimilar - Anti-VEGF Receptor 1 Antibody - BSA and Azide free (A318839) - Antibodies.com
(3)
A318839
Icrucumab Biosimilar - Anti-VEGF Receptor 1 Antibody - BSA and Azide free
Recombinant human monoclonal antibody to VEGF Receptor 1 for ELISA and Flow Cytometry.
SDS-PAGE - Anti-VEGF Receptor 1 Antibody [FLT1/658] (A248570) - Antibodies.com
A248571
Anti-VEGF Receptor 1 Antibody [FLT1/658]
Mouse monoclonal [FLT1/658] antibody to VEGF Receptor 1 for Flow Cytometry, IF and Functional Studies.
Antibodies.com Image Placeholder - Discover more for less
A323495
Icrucumab Biosimilar - Anti-VEGF Receptor 1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to VEGF Receptor 1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-VEGF Receptor 1 Antibody [FLT1/1663] - BSA and Azide free (A278199) - Antibodies.com
A278199
Anti-VEGF Receptor 1 Antibody [FLT1/1663] - BSA and Azide free
Mouse monoclonal [FLT1/1663] antibody to VEGF Receptor 1 for Flow Cytometry, IF and Functional Studies.
SDS-PAGE - Anti-VEGF Receptor 1 Antibody [FLT1/658] - BSA and Azide free (A251752) - Antibodies.com
A251753
Anti-VEGF Receptor 1 Antibody [FLT1/658] - BSA and Azide free
Mouse monoclonal [FLT1/658] antibody to VEGF Receptor 1 for Flow Cytometry, IF and Functional Studies.
SDS-PAGE - Anti-VEGF Receptor 1 Antibody [FLT1/1663] (A277611) - Antibodies.com
A277611
Anti-VEGF Receptor 1 Antibody [FLT1/1663]
Mouse monoclonal [FLT1/1663] antibody to VEGF Receptor 1 for Flow Cytometry, IF and Functional Studies.
Antibodies.com Image Placeholder - Discover more for less
A324588
Anti-VEGF Receptor 1 Antibody [IHC086]
Rabbit monoclonal [IHC086] antibody to VEGF Receptor 1 for IHC-P.
Anti-VEGFR1 Antibody from FabGennix (VEGFR1-101AP) - Antibodies.com
A54530
Anti-VEGFR1 Antibody
Rabbit polyclonal antibody to VEGFR1 for ELISA, IHC, IP and WB.
Western blot - Flt-1 (Phospho-Tyr1333) Polyclonal Antibody from Signalway Antibody (12310) - Antibodies.com
A50268
Anti-Flt-1 (Phospho-Tyr1333) Antibody
Rabbit polyclonal antibody to Flt-1 (Phospho-Tyr1333) for WB, IHC and ELISA.
Western Blot - Anti-VEGF Receptor 1 Antibody (A12509) - Antibodies.com
(3)
A12509
Anti-VEGF Receptor 1 Antibody
Rabbit polyclonal antibody to VEGF Receptor 1 for WB and ICC/IF.
SDS-PAGE - Anti-VEGF Receptor 1 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free (A324288) - Antibodies.com
(2)
A324288
Anti-VEGF Receptor 1 Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free
Recombinant human monoclonal antibody to VEGF Receptor 1 for ELISA, FACS, Functional Assay and In Vivo.
Western Blot - Anti-VEGF Receptor 1 Antibody [ARC0363] (A307992) - Antibodies.com
(2)
A307992
Anti-VEGF Receptor 1 Antibody [ARC0363]
Rabbit monoclonal [ARC0363] antibody to VEGF Receptor 1 for WB.
ELISA - Icrucumab Biosimilar - Anti-VEGF Receptor 1 Antibody - BSA and Azide free (A318839) - Antibodies.com
(3)
A318839
Icrucumab Biosimilar - Anti-VEGF Receptor 1 Antibody - BSA and Azide free
Recombinant human monoclonal antibody to VEGF Receptor 1 for ELISA and Flow Cytometry.
SDS-PAGE - Anti-VEGF Receptor 1 Antibody [FLT1/658] (A248570) - Antibodies.com
A248571
Anti-VEGF Receptor 1 Antibody [FLT1/658]
Mouse monoclonal [FLT1/658] antibody to VEGF Receptor 1 for Flow Cytometry, IF and Functional Studies.
Antibodies.com Image Placeholder - Discover more for less
A323495
Icrucumab Biosimilar - Anti-VEGF Receptor 1 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to VEGF Receptor 1 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-VEGF Receptor 1 Antibody [FLT1/1663] - BSA and Azide free (A278199) - Antibodies.com
A278199
Anti-VEGF Receptor 1 Antibody [FLT1/1663] - BSA and Azide free
Mouse monoclonal [FLT1/1663] antibody to VEGF Receptor 1 for Flow Cytometry, IF and Functional Studies.
SDS-PAGE - Anti-VEGF Receptor 1 Antibody [FLT1/658] - BSA and Azide free (A251752) - Antibodies.com
A251753
Anti-VEGF Receptor 1 Antibody [FLT1/658] - BSA and Azide free
Mouse monoclonal [FLT1/658] antibody to VEGF Receptor 1 for Flow Cytometry, IF and Functional Studies.
SDS-PAGE - Anti-VEGF Receptor 1 Antibody [FLT1/1663] (A277611) - Antibodies.com
A277611
Anti-VEGF Receptor 1 Antibody [FLT1/1663]
Mouse monoclonal [FLT1/1663] antibody to VEGF Receptor 1 for Flow Cytometry, IF and Functional Studies.
Antibodies.com Image Placeholder - Discover more for less
A324588
Anti-VEGF Receptor 1 Antibody [IHC086]
Rabbit monoclonal [IHC086] antibody to VEGF Receptor 1 for IHC-P.
Anti-VEGFR1 Antibody from FabGennix (VEGFR1-101AP) - Antibodies.com
A54530
Anti-VEGFR1 Antibody
Rabbit polyclonal antibody to VEGFR1 for ELISA, IHC, IP and WB.
Western blot - Flt-1 (Phospho-Tyr1333) Polyclonal Antibody from Signalway Antibody (12310) - Antibodies.com
A50268
Anti-Flt-1 (Phospho-Tyr1333) Antibody
Rabbit polyclonal antibody to Flt-1 (Phospho-Tyr1333) for WB, IHC and ELISA.
See all VEGF Receptor 1 Antibodies