Anti-STAT3 Anticorps (A13365)

Name: Anti-STAT3 Antibody
Brand: Antibodies.com
SKU: A13365
Price: 335.0 USD
Availability: InStock

Cliquez pour ouvrir le point de vue élargi

$335

Anticorps polyclonal de lapin contre STAT3 pour WB, IHC et ICC/IF.

Qualité 100 % Garantie

Garantie de Correspondance des Prix

Livraison

Frais de livraison

$40

Date de livraison

Livraison sous 5-8 jours ouvrables.

Nous ContacterContact

Téléphone

+1 (314) 370-6046

E-mail

orders@antibodies.com

Garanties

Qualité 100 % Garantie

Garantie de Correspondance des Prix

Spécifications

Nom du produit

Anti-STAT3 Antibody

Description du produit

Rabbit polyclonal antibody to STAT3.

Applications

WB, IHC, ICC/IF

Recommander des dilutions

WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200

Reactivité

Human, Mouse, Rat

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 600-700 of human STAT3 (NP_003141.2).

Séquence

TKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPG

Hôte

Rabbit

Clonalité

Polyclonal

Isotype

IgG

Conjuguer

Unconjugated

Purification

Affinity purification.

Masse moléculaire

86 kDa

Forme du produit

Liquid

Formulation

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Stockage

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Synonymes

1110034C02Rik, Acute Phase Response Factor, Acute-phase response factor, ADMIO, APRF, AW109958, DNA binding protein APRF, FLJ20882, HIES, MGC16063, Signal transducer and activator of transcription 3, Signal transducer and activator of transcription 3 (acute phase response factor), STAT 3, STAT3_HUMAN

Contrôles isotype

Anticorps secondaires appropriés

Avertissement

Ce produit est uniquement destiné à la recherche. Il n'est pas destiné à un usage diagnostique ou thérapeutique.

Images (11)

Cliquez pour ouvrir le point de vue élargi

Figure 1: Western Blot - Anti-STAT3 Antibody (A13365)

Western blot analysis of various lysates, using Anti-STAT3 Antibody (A13365) at 1:2,500 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 60s.

Cliquez pour ouvrir le point de vue élargi

Figure 2: Immunohistochemistry - Anti-STAT3 Antibody (A13365)

Immunohistochemistry analysis of paraffin-embedded mouse brain using Anti-STAT3 Antibody (A13365) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 3: Immunohistochemistry - Anti-STAT3 Antibody (A13365)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using Anti-STAT3 Antibody (A13365) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 4: Immunohistochemistry - Anti-STAT3 Antibody (A13365)

Immunohistochemistry analysis of paraffin-embedded rat heart using Anti-STAT3 Antibody (A13365) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 5: Immunohistochemistry - Anti-STAT3 Antibody (A13365)

Immunohistochemistry analysis of paraffin-embedded rat kidney using Anti-STAT3 Antibody (A13365) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 6: Immunofluorescence - Anti-STAT3 Antibody (A13365)

Immunofluorescence analysis of NIH/3T3 cells using Anti-STAT3 Antibody (A13365) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Cliquez pour ouvrir le point de vue élargi

Figure 7: Immunofluorescence - Anti-STAT3 Antibody (A13365)

Immunofluorescence analysis of PC-12 cells using Anti-STAT3 Antibody (A13365) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Cliquez pour ouvrir le point de vue élargi

Figure 8: Immunofluorescence - Anti-STAT3 Antibody (A13365)

Immunofluorescence analysis of U2OS cells using Anti-STAT3 Antibody (A13365) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Cliquez pour ouvrir le point de vue élargi

Figure 9: Immunofluorescence - Anti-STAT3 Antibody (A13365)

Immunofluorescence analysis of NIH/3T3 cells using Anti-STAT3 Antibody (A13365) at a dilution of 1:200 (40x lens). DAPI was used to stain the cell nuclei (blue).

Cliquez pour ouvrir le point de vue élargi

Figure 10: Immunofluorescence - Anti-STAT3 Antibody (A13365)

Immunofluorescence analysis of PC-12 cells using Anti-STAT3 Antibody (A13365) at a dilution of 1:200 (40x lens). DAPI was used to stain the cell nuclei (blue).

Cliquez pour ouvrir le point de vue élargi

Figure 11: Immunofluorescence - Anti-STAT3 Antibody (A13365)

Immunofluorescence analysis of U2OS cells using Anti-STAT3 Antibody (A13365) at a dilution of 1:200 (40x lens). DAPI was used to stain the cell nuclei (blue).

Voir plus de photos