Anti-Renin Receptor Anticorps (A9906)

Anti-Renin Receptor Antibody

Rabbit polyclonal antibody to Renin Receptor.

WB

WB: 1:500-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 251-350 of human ATP6AP2 (NP_005756.2).

MYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

APT6M8 9, APT6M8-9, ATP6AP2, ATP6IP2, ATP6M8-9, ATPase H(+)-transporting lysosomal accessory protein 2, ATPase H(+)-transporting lysosomal-interacting protein 2, ATPase H+ transporting lysosomal accessory protein 2, ATPase H+ transporting lysosomal interacting protein 2, ATPase H+ transporting lysosomal vacuolar proton pump membrane sector associated protein M8 9, ATPase membrane sector associated protein M8 9, ATPase, H+ transporting, lysosomal (vacuolar proton pump) membrane sector associated protein M8 9, CAPER, ELDF10, Embryonic liver differentiation factor 10, ER localized type I transmembrane adaptor, ER-localized type I transmembrane adaptor, HT028, M8 9, M8-9, MGC99577, MRXE, MSTP009, N14F, Renin/prorenin receptor, RENR_HUMAN, V ATPase M8 9 subunit, V ATPase M8.9 subunit, V-ATPase M8.9 subunit, Vacuolar ATP synthase membrane sector associated protein M8 9, Vacuolar ATP synthase membrane sector-associated protein M8-9, vacuolar proton ATP synthase membrane sector associated protein M8 9, XMRE