Recombinant Humain Resistin Protéine (N-terminal His Tag) (A61404)

Recombinant Human Resistin Protein (N-terminal His Tag)

SDS-PAGE

Escherichia coli

Recombinant

Human

Protein fragment

SSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP

N-terminal His Tag

14.23 kDa

Liquid

Lot Specific

Supplied in 20 mM Tris HCl Buffer, pH 8, with 5 mM EDTA and 50% Glycerol.

Shipped at 4°C. Short term (2-4 weeks) store at 4°C. Long term store at -20°C. Avoid freeze/thaw cycles.

Adipose tissue specific secretory factor , Adipose tissue-specific secretory factor, ADSF, C/EBP epsilon regulated myeloid specific secreted cysteine rich protein, C/EBP epsilon regulated myeloid specific secreted cysteine rich protein precursor 1 , C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, CG5403, Cysteine rich secreted protein A12 alpha like 2 , Cysteine rich secreted protein FIZZ3, Cysteine-rich secreted protein A12-alpha-like 2, Cysteine-rich secreted protein FIZZ3, dri, FIZZ 3, FIZZ3, Found in inflammatory zone 3, HXCP 1, HXCP1, MGC126603, MGC126609, PRO1199, Resistin delta2 , RETN, RETN 1, RETN1, RETN_HUMAN, RSTN, UNQ407 , XCP 1 , XCP1