Recombinant Humain Rb Protéine (C-terminal His Tag) (A60984)

Recombinant Human Rb Protein (C-terminal His Tag)

SDS-PAGE

Escherichia coli

Recombinant

Human

Protein fragment

MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEKHHHHHH

C-terminal His Tag

>95% as determined by RP-HPLC and SDS-PAGE.

Lyophilized

Reconstitution dependent.

Lyophilized from Phosphate Buffered Saline, pH 7.4.

Shipped at ambient temperature. Lyophilized: Short term (3 weeks) store at 25°C. Long term store desiccated below -18°C. Reconstituted: Short term (2-7 days) store at 4°C. Long term store below -18°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid freeze/thaw cycles.

Exon 17 tumor GOS561 substitution mutation causes premature stop, GOS563 exon 17 substitution mutation causes premature stop, OSRC, Osteosarcoma, p105-Rb, P105RB, PP105, pp110, PPP1R130, pRb, Prepro retinoblastoma associated protein, Protein phosphatase 1 regulatory subunit 130, RB transcriptional corepressor 1, RB1, RB1 gene, RB_HUMAN, Retinoblastoma 1, Retinoblastoma suspectibility protein, Retinoblastoma-associated protein