Recombinant Humain PDGF B Protéine (N-terminal His Tag) (A63304)

Recombinant Human PDGF B Protein (N-terminal His Tag)

SDS-PAGE

Escherichia coli

Recombinant

Human

Protein fragment

SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

N-terminal His Tag

16.75 kDa

Liquid

Lot Specific

Supplied at pH 4.8 with 25 mM Sodium Acetate, 1 mM EDTA, and 50% Glycerol.

Shipped at 4°C. Short term (2-4 weeks) store at 4°C. Long term store at -20°C. Avoid freeze/thaw cycles.

Becaplermin, c sis, FLJ12858, Oncogene SIS, PDGF 2, PDGF B chain, PDGF Beta, PDGF subunit B, PDGF-2, PDGF2, Pdgfb, PDGFB_HUMAN, Platelet derived growth factor 2, Platelet derived growth factor B chain, Platelet derived growth factor beta, Platelet derived growth factor beta polypeptide, Platelet derived growth factor beta polypeptide (oncogene SIS), Platelet derived growth factor beta polypeptide (simian sarcoma viral (v sis) oncogene homolog), Platelet-derived growth factor B chain, Platelet-derived growth factor beta polypeptide, Platelet-derived growth factor subunit B, Proto-oncogene c-Sis, Simian sarcoma viral (v sis) oncogene homolog, SIS, SSV, v sis platelet derived growth factor beta polypeptide