Recombinant Humain Osteoprotegerin Protéine (His Tag) (A63230)

Recombinant Human Osteoprotegerin Protein (His Tag)

WB, Antibody Production, Protein Assay

Escherichia coli

Recombinant

Human

Protein fragment

LCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL

His Tag

>80% as determined by RP-HPLC and SDS-PAGE.

Lyophilized

1mg/ml

Lyophilized from Phosphate Buffered Saline with 0.1% SDS and 1 mM DTT.

Shipped at ambient temperature. Lyophilized: Short term (3 weeks) store at 25°C. Long term store desiccated below -18°C. Reconstituted: Short term (2-7 days) store at 4°C. Long term store below -18°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid freeze/thaw cycles.

MGC29565 , MGC93568, OCIF , OPG, Osteoclastogenesis inhibitory factor, PDB5, TNF receptor superfamily member 11b, TNFRSF 11B, TNFRSF11B, TR 1, TR1, TR11B_HUMAN, Tumor necrosis factor receptor superfamily member 11B