Recombinant Humain Galectin 7 Protéine (A63273)

Recombinant Human Galectin 7 Protein

SDS-PAGE

Escherichia coli

Recombinant

Human

Full length protein

MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

15 kDa

Lyophilized

1 mg/ml

Lyophilized from 20 mM Tris Buffer, pH 8, with 150 mM Sodium Chloride, 5% Trehalose, and 1 mM EDTA.

Shipped at ambient temperature. Lyophilized: Short term (3 weeks) store at 25°C. Long term store desiccated below -18°C. Reconstituted: Short term (2-7 days) store at 4°C. Long term store below -18°C. Avoid freeze/thaw cycles.

Gal-7, GAL7, Galectin 7B, Galectin-7, HKL-14, HKL14, Human keratinocyte lectin 14 , Keratinocyte lectin 14, Lectin galactoside binding soluble 7 , Lectin, galactoside binding, soluble, 7B, LEG7_HUMAN, LGALS7, LGALS7A, LGALS7B, MGC151215, MGC151217, OTTMUSP00000025970, OTTMUSP00000038956, p53 induced gene 1 protein, P53 induced protein 1, p53-induced gene 1 protein, PI7, PIG1, TP53I1