Recombinant Humain BCA1 Protéine (A61317)

Recombinant Human BCA1 Protein

Chemotaxis

Escherichia coli

Recombinant

Human

Protein fragment

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNG CPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR SSSTLPVPVFKRKIP

10.3 kDa

Yes

Determined by its ability to chemoattract human B cells using a concentration range of 1-10 ng/ml corresponding to a Specific Activity of 100,000-1,000,000 IU/mg.

Lyophilized

0.5mg/ml

Lyophilized from 20 mM Phosphate Buffered Saline, pH 7.4, with 150 mM Sodium Chloride.

Shipped at ambient temperature. Lyophilized: Short term (3 weeks) store at 25°C. Long term store desiccated below -18°C. Reconstituted: Short term (2-7 days) store at 4°C. Long term store below -18°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid freeze/thaw cycles.

ANGIE , ANGIE2 , B cell attracting chemokine 1, B cell chemoattractant , B cell homing chemokine (ligand for Burkitt's lymphoma receptor 1), B cell-attracting chemokine 1, B lymphocyte chemoattractant , B-cell chemoattractant, B-cell-attracting chemokine 1, B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1), BCA 1, BCA-1, BLC, BLR1L, C X C motif chemokine 13 , C-X-C motif chemokine 13, Chemokine (C X C motif) ligand 13 , Chemokine (C X C motif) ligand 13 (B cell chemoattractant) , Chemokine (C-X-C motif) ligand 13, Chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant), Chemokine CXC motif ligand 13 , Chemokine, CXC motif, ligand 13, CXC chemokine BLC, CXCL13 , CXL13_HUMAN, SCYB13, Small inducible cytokine B subfamily (Cys X Cys motif) member 13 (B cell chemoattractant), Small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant), Small inducible cytokine B13, Small inducible cytokine subfamily B, member 13 , Small-inducible cytokine B13