Anti-Rad21 Anticorps (A305614)

Name: Anti-Rad21 Antibody
Brand: Antibodies.com
SKU: A305614
Price: 335.0 USD
Availability: InStock

Cliquez pour ouvrir le point de vue élargi

$335

Anticorps polyclonal de lapin contre Rad21 pour WB, IHC, ICC/IF, IP et ChIP.

Qualité 100 % Garantie

Garantie de Correspondance des Prix

Livraison

Frais de livraison

$40

Date de livraison

Livraison sous 5-8 jours ouvrables.

Nous ContacterContact

Téléphone

+1 (314) 370-6046

E-mail

orders@antibodies.com

Garanties

Qualité 100 % Garantie

Garantie de Correspondance des Prix

Spécifications

Nom du produit

Anti-Rad21 Antibody

Description du produit

Rabbit polyclonal antibody to Rad21.

Applications

WB, IHC, ICC/IF, IP, ChIP

Recommander des dilutions

WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200, IP: 1:500-1:1,000, ChIP: 1:500-1:1,000

Reactivité

Human, Mouse, Rat

Immunogène

Recombinant fusion protein containing a sequence corresponding to amino acids 268-429 of human Rad21 (NP_006256.1).

Séquence

DNVSMGGPDSPDSVDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEFENPEVPRED

Hôte

Rabbit

Clonalité

Polyclonal

Isotype

IgG

Conjuguer

Unconjugated

Purification

Affinity purification.

Masse moléculaire

130 kDa

Forme du produit

Liquid

Formulation

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Stockage

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Synonymes

CDLS4, Double-strand-break repair protein rad21 homolog, hHR21, HR21, HRAD21, KIAA0078, MCD1, Nuclear matrix protein 1, NXP-1, NXP1, Protein involved in DNA double-strand break repair, RAD21 homolog, RAD21 homolog (S. pombe), RAD21_HUMAN, Scc1, SCC1 homolog

Contrôles isotype

Anticorps secondaires appropriés

Avertissement

Ce produit est uniquement destiné à la recherche. Il n'est pas destiné à un usage diagnostique ou thérapeutique.

Images (10)

Cliquez pour ouvrir le point de vue élargi

Figure 1: Western Blot - Anti-Rad21 Antibody (A305614)

Western blot analysis of extracts of various cell lines, using Anti-Rad21 Antibody (A305614) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 10s.

Cliquez pour ouvrir le point de vue élargi

Figure 2: Western Blot - Anti-Rad21 Antibody (A305614)

Western blot analysis of extracts of C6 cells, using Anti-Rad21 Antibody (A305614) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Enhanced Kit (RM00021). Exposure time: 90s.

Cliquez pour ouvrir le point de vue élargi

Figure 3: Immunohistochemistry - Anti-Rad21 Antibody (A305614)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma tissue using Anti-Rad21 Antibody (A305614) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 4: Immunohistochemistry - Anti-Rad21 Antibody (A305614)

Immunohistochemistry analysis of paraffin-embedded mouse stomach using Anti-Rad21 Antibody (A305614) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 5: Immunohistochemistry - Anti-Rad21 Antibody (A305614)

Immunohistochemistry analysis of paraffin-embedded rat stomach using Anti-Rad21 Antibody (A305614) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 6: Immunofluorescence - Anti-Rad21 Antibody (A305614)

Immunofluorescence analysis of U2OS cells using Anti-Rad21 Antibody (A305614) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Cliquez pour ouvrir le point de vue élargi

Figure 7: Western Blot - Anti-Rad21 Antibody (A305614)

Immunoprecipitation analysis of 300µg extracts of Jurkat cells using 3µg of Anti-Rad21 Antibody (A305614). This Western blot was performed on the immunoprecipitate using Anti-Rad21 Antibody (A305614) at a dilution of 1:1000.

Cliquez pour ouvrir le point de vue élargi

Figure 8: Western Blot - Anti-Rad21 Antibody (A305614)

Cliquez pour ouvrir le point de vue élargi

Figure 9: Chromatin Immunoprecipitation - Anti-Rad21 Antibody (A305614)

Chromatin immunoprecipitation (ChIP) analysis of extracts of A-549 cells, using Anti-Rad21 Antibody (A305614) and Rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.