Anti-RACK1 Anticorps (A89406)

Anti-RACK1 Antibody

Rabbit polyclonal antibody to RACK1.

WB, ICC/IF

WB: 1:500-1:2,000, ICC/IF: 1:50-1:200

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 30-290 of human RACK1 (NP_006089.1).

MILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEPPQCTSLA

Rabbit

Polyclonal

IgG

Unconjugated

35 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Cell proliferation-inducing gene 21 protein, GBLP_HUMAN, Gnb2-rs1, Gnb2l1, Guanine nucleotide binding protein (G protein) beta polypeptide 2 like 1, Guanine nucleotide binding protein beta polypeptide 2 like 1, Guanine nucleotide binding protein beta subunit 2 like 1, Guanine nucleotide binding protein beta subunit like protein 12.3, Guanine nucleotide binding protein subunit beta 2 like 1, Guanine nucleotide binding protein subunit beta like protein 12.3, Guanine nucleotide-binding protein subunit beta-2-like 1, Guanine nucleotide-binding protein subunit beta-like protein 12.3, H12.3, HLC-7, Human lung cancer oncogene 7 protein, lung cancer oncogene 7, OTTHUMP00000223704, OTTHUMP00000223870, OTTHUMP00000223891, OTTHUMP00000223893, OTTHUMP00000223900, OTTHUMP00000223902, OTTHUMP00000223930, OTTHUMP00000223931, PIG21, Proliferation inducing gene 21, Protein homologous to chicken B complex protein guanine nucleotide binding, Receptor for activated C kinase, Receptor for activated C kinase 1, Receptor of activated protein kinase C 1