Anti-PSMA Anticorps [GCP-04] (A280506)

Anti-PSMA Antibody [GCP-04]

Mouse monoclonal [GCP-04] antibody to PSMA.

This antibody recognises amino acids 100-104 of the extracellular domain of prostate specific membrane antigen (PSMA), otherwise known as GCPII (glutamate carboxypeptidase II), a 95-110 kDa type II transmembrane glycoprotein and member of the peptidase M28 family. Nomenclature for GCPII is dependent upon tissue specificity. PSMA is assigned to GCPII of prostate origin which is up-regulated in prostate cancer and a reliable diagnostic marker. Folate hydrolase (FOLH1) describes GCPII in the intestine and is required for folate uptake, whilst NAALADase refers to GCPII expressed in the central nervous system, which acts to cleave N-acetylaspartylglutamate (NAAG) to release glutamate, implicated in pathological conditions including Alzheimer’s and Huntington’s disease.

WB, IHC-P

Human, Rat, Pig

Recombinant fragment corresponding to amino acids 44-750 of human GCPII.

KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA

Mouse

Monoclonal

GCP-04

IgG1

Unconjugated

1 mg/ml

Liquid

Supplied in Phosphate Buffered Saline with <0.1% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti prostate specific Membrane Antigen antibody, clone GCP-04 recognises amino acids 100-104 of the extracellular domain of prostate specific membrane antigen (PSMA), otherwise known as GCPII (glutamate carboxypeptidase II), a 95-110 kDa type II transmembrane glycoprotein and member of the peptidase M28 family. Nomenclature for GCPII is dependent upon tissue specificity. PSMA is assigned to GCPII of prostate origin which is up-regulated in prostate cancer and a reliable diagnostic marker. Folate hydrolase (FOLH1) describes GCPII in the intestine and is required for folate uptake, whilst NAALADase refers to GCPII expressed in the central nervous system, which acts to cleave N-acetylaspartylglutamate (NAAG) to release glutamate, implicated in pathological conditions including Alzheimer’s and Huntington’s disease.

Cell growth inhibiting protein 27, Cell growth-inhibiting gene 27 protein, FGCP, Folate hydrolase, Folate hydrolase (prostate-specific membrane antigen) 1, Folate hydrolase 1, Folate hydrolase prostate specific membrane antigen 1, FOLH, FOLH 1, Folh1, FOLH1_HUMAN, Folylpoly gamma glutamate carboxypeptidase, Folylpoly-gamma-glutamate carboxypeptidase, GCP 2, GCP II, GCP2, GCPII, GIG27, Glutamate carboxylase II, Glutamate carboxypeptidase 2, Glutamate carboxypeptidase II, Membrane glutamate carboxypeptidase, mGCP, N acetylated alpha linked acidic dipeptidase 1, N-acetylated-alpha-linked acidic dipeptidase I, NAALAD 1, NAALAD1, NAALAdase, NAALADase I, Prostate specific membrane antigen, Prostate specific membrane antigen variant F, Prostate-specific membrane antigen, PSM, Pteroylpoly gamma glutamate carboxypeptidase, Pteroylpoly-gamma-glutamate carboxypeptidase