Anti-PRKAR1A Anticorps (A12710)

Anti-PRKAR1A Antibody

Rabbit polyclonal antibody to PRKAR1A.

WB, ICC/IF

WB: 1:500-1:1,000, ICC/IF: 1:50-1:200

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 300-386 of human PRKAR1A (NP_002725.1).

AAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV

Rabbit

Polyclonal

IgG

Unconjugated

48 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

ACRDYS1, ADOHR, cAMP dependent protein kinase regulatory subunit alpha 1, cAMP dependent protein kinase regulatory subunit RIalpha, cAMP dependent protein kinase type I alpha regulatory chain, cAMP dependent protein kinase type I alpha regulatory subunit, cAMP-dependent protein kinase type I-alpha regulatory subunit, CAR, Carney complex type 1, CNC, CNC 1, CNC1, DKFZp779L0468, KAP0_HUMAN, MGC17251, PKA RIA, PKR 1, PKR1, PPNAD 1, PPNAD1, PRKAR 1, PRKAR1, PRKAR1A/RARA FUSION GENE, Protein Kinase A regulatory subunit I alpha, Protein kinase A type 1a regulatory subunit, Protein kinase cAMP dependent regulatory type I alpha, PTC2 CHIMERIC ONCOGENE, INCLUDED, Tissue specific extinguisher 1, Tissue-specific extinguisher 1, TSE 1, TSE1