Anti-PPP2R4 Anticorps (A13737)

Anti-PPP2R4 Antibody

Rabbit polyclonal antibody to PPP2R4.

ICC/IF

ICC/IF: 1:50-1:200

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human Ser/thr-PP2A activator (PTPA) (NP_821067.1).

MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG

Rabbit

Polyclonal

IgG

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

KIAA0044, MGC2184, Phosphotyrosyl phosphatase activator, PP2A, PP2A phosphatase activator, PP2A subunit B', PP2A subunit B' isoform PR53, PP2A subunit B' PR53 isoform, PR53, PR53 isoform, Protein phosphatase 2, regulatory subunit B-prime, Protein phosphatase 2A activator regulatory subunit 4, Protein phosphatase 2A regulatory subunit B' (PR 53), PTPA, PTPA_HUMAN, Serine/threonine protein phosphatase 2A regulatory subunit B', Serine/threonine-protein phosphatase 2A activator, Serine/threonine-protein phosphatase 2A regulatory subunit 4, Serine/threonine-protein phosphatase 2A regulatory subunit B'', subunit B''