Anti-PIMT Anticorps (A12180)

Anti-PIMT Antibody

Rabbit polyclonal antibody to PIMT.

WB

WB: 1:500-1:2,000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 714-853 of human TGS1 (NP_079107.6).

RVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWGGPDYATAETFDIRTMMSPDGFEIFRLSKKITNNIVYFLPRNADIDQVASLAGPGGQVEIEQNFLNNKLKTITAYFGDLIRRPASET

Rabbit

Polyclonal

IgG

Unconjugated

97 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Cap specific guanine N2 methyltransferase, Cap-specific guanine-N2 methyltransferase, CLL associated antigen KW 2, CLL-associated antigen KW-2, DKFZp762A163, FLJ22995, HCA137, Hepatocellular carcinoma associated antigen 137, Hepatocellular carcinoma-associated antigen 137, NCOA6IP, Nuclear receptor coactivator 6 interacting protein, Nuclear receptor coactivator 6-interacting protein, PIPMT, PRIP interacting protein PIPMT, PRIP interacting protein with methyltransferase domain, PRIP interacting protein with methyltransferase motif, PRIP-interacting protein with methyltransferase motif, SEREX defined, TGS 1, Tgs1, TGS1_HUMAN, Trimethylguanosine synthase, Trimethylguanosine synthase homolog, Trimethylguanosine synthase homolog (S. cerevisiae)