Anti-P-Selectin Anticorps (A91439)

Anti-P-Selectin Antibody

Rabbit polyclonal antibody to P-Selectin.

WB

WB: 1:500-1:2,000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 220-319 of human CD62P/P-selectin (NP_002996.2).

FSFNSQCSFHCTDGYQVNGPSKLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVGPEVVQCTASGVWTAPAPVC

Rabbit

Polyclonal

IgG

Unconjugated

91 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Antigen CD62, CD62, CD62 antigen like family member P, CD62 antigen-like family member P, CD62P, FLJ45155, GMP 140, GMP-140, GMP140, GMRP, Granule membrane protein 140, Granule membrane protein 140kDa, Granulocyte membrane protein, GRMP, LECAM 3, LECAM3, Leukocyte endothelial cell adhesion molecule 3 , Leukocyte-endothelial cell adhesion molecule 3, LYAM3_HUMAN, P selectin, PADGEM, Platelet activation dependent granule external membrane protein, Platelet activation dependent granule-external membrane protein, Platelet alpha granule membrane protein, PSEL, Selectin P, Selectin P (granule membrane protein 140kDa antigen CD62), Selectin P (granule membrane protein 140kDa, antigen CD62), SELP