Anti-LILRB1 Anticorps (A87909)

Anti-LILRB1 Antibody

Rabbit polyclonal antibody to LILRB1.

WB

WB: 1:500-1:2,000

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 350-460 of human LILRB1 (Q8NHL6).

GWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHLG

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

CD85, CD85 antigen, CD85 antigen like family member J, CD85 antigen-like family member J, CD85j, CD85j antigen, Ig like transcript 2, ILT 2, ILT-2, ILT2, immunoglobulin like transcript 2, Immunoglobulin-like transcript 2, leukocyte Ig like receptor 1, Leukocyte immunoglobulin like receptor 1, leukocyte immunoglobulin like receptor subfamily B member 1, Leukocyte immunoglobulin like receptor subfamily B member 1 precursor, leukocyte immunoglobulin like receptor subfamily B member 1 soluble isoform, leukocyte immunoglobulin like receptor, subfamily B, member 1, Leukocyte immunoglobulin-like receptor 1, Leukocyte immunoglobulin-like receptor subfamily B member 1, leukocyte immunoglobulin-like receptor subfamily B member 1 soluble isoform, leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1, LIR 1, LIR-1, LIR1, LIRB1_HUMAN, MIR 7, MIR-7, MIR7, Monocyte/macrophage immunoglobulin like receptor 7, Monocyte/macrophage immunoglobulin-like receptor 7, PIR B, PIRB