Anti-IP10 Anticorps (A309104)

Anti-IP10 Antibody

Rabbit polyclonal antibody to IP10.

WB, ICC/IF

WB: 1:1,000-1:5,000, ICC/IF: 1:50-1:200

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 22-98 of human CXCL10/IP-10 (NP_001556.2).

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

10 kDa interferon gamma induced protein, 10 kDa interferon gamma-induced protein, C X C motif chemokine 10, C7, Chemokine (C X C motif) ligand 10, Chemokine CXC motif ligand 10, Crg 2, CRG2, CXCL10, CXCL10(1-73), CXL10_HUMAN, Gamma IP10, Gamma-IP10, gIP 10, GIP10, IFI10, INP 10, INP10, Interferon activated gene 10 , Interferon gamma induced cell line, Interferon gamma induced factor MOB1, mouse, homolog of, Interferon gamma induced protein 10, Interferon inducible cytokine IP 10, Interferon inducible cytokine IP10, IP 10, IP-10, Mob 1, MOB1, Protein 10 from interferon (gamma) induced cell line, SCYB10, Small inducible cytokine B10, Small inducible cytokine B10 precursor, Small inducible cytokine subfamily B (Cys X Cys) member 10, Small inducible cytokine subfamily B CXC member 10 , Small inducible cytokine subfamily B, member 10, Small-inducible cytokine B10