Anti-IKZF3 Anticorps [ARC2781] (A306354)

Name: Anti-IKZF3 Antibody [ARC2781]
Brand: Antibodies.com
SKU: A306354
Price: 470.0 USD
Availability: InStock

Cliquez pour ouvrir le point de vue élargi

$470

Anticorps monoclonal [ARC2781] de lapin contre IKZF3 pour WB, IHC, ICC/IF et IP.

Qualité 100 % Garantie

Garantie de Correspondance des Prix

Livraison

Frais de livraison

$40

Date de livraison

Livraison sous 5-8 jours ouvrables.

Nous ContacterContact

Téléphone

+1 (314) 370-6046

E-mail

orders@antibodies.com

Garanties

Qualité 100 % Garantie

Garantie de Correspondance des Prix

Spécifications

Nom du produit

Anti-IKZF3 Antibody [ARC2781]

Description du produit

Rabbit monoclonal [ARC2781] antibody to IKZF3.

Applications

WB, IHC, ICC/IF, IP

Recommander des dilutions

WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:50-1:200, IP: 1:100-1:500

Reactivité

Human, Mouse, Rat

Immunogène

Recombinant fusion protein containing a sequence corresponding to amino acids 400-509 of human IKZF3 (Q9UKT9).

Séquence

IYQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGYRSHDRYEFSSHIARGEHRALLK

Hôte

Rabbit

Clonalité

Monoclonal

Clone

ARC2781

Isotype

IgG

Conjuguer

Unconjugated

Purification

Affinity purification.

Masse moléculaire

65 kDa

Forme du produit

Liquid

Formulation

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Stockage

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Synonymes

AIO, Aiolos, IKAROS family zinc finger 3, IKAROS family zinc finger 3 (Aiolos), Ikaros family zinc finger protein 3, IKZF 3, IKZF3_HUMAN, zinc finger DNA binding protein Aiolos, Zinc finger protein Aiolos, Zinc finger protein subfamily 1A 3, Zinc finger protein subfamily 1A 3 (Aiolos), Zinc finger protein subfamily 1A, member 3, ZNFN1A3

Contrôles isotype

Anticorps secondaires appropriés

Avertissement

Ce produit est uniquement destiné à la recherche. Il n'est pas destiné à un usage diagnostique ou thérapeutique.

Images (10)

Cliquez pour ouvrir le point de vue élargi

Figure 1: Western Blot - Anti-IKZF3 Antibody [ARC2781] (A306354)

Western blot analysis of extracts of Raji cells, using Anti-IKZF3 Antibody [ARC2781] (A306354) at 1:500 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 3s.

Cliquez pour ouvrir le point de vue élargi

Figure 2: Western Blot - Anti-IKZF3 Antibody [ARC2781] (A306354)

Western blot analysis of extracts of various cell lines, using Anti-IKZF3 Antibody [ARC2781] (A306354) at 1:500 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 60s.

Cliquez pour ouvrir le point de vue élargi

Figure 3: Western Blot - Anti-IKZF3 Antibody [ARC2781] (A306354)

Western blot analysis of extracts of Rat lung, using Anti-IKZF3 Antibody [ARC2781] (A306354) at 1:500 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Enhanced Kit (RM00021). Exposure time: 90s.

Cliquez pour ouvrir le point de vue élargi

Figure 4: Immunohistochemistry - Anti-IKZF3 Antibody [ARC2781] (A306354)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma tissue using Anti-IKZF3 Antibody [ARC2781] (A306354) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 5: Immunohistochemistry - Anti-IKZF3 Antibody [ARC2781] (A306354)

Immunohistochemistry analysis of paraffin-embedded human tonsil using Anti-IKZF3 Antibody [ARC2781] (A306354) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 6: Immunohistochemistry - Anti-IKZF3 Antibody [ARC2781] (A306354)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using Anti-IKZF3 Antibody [ARC2781] (A306354) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 7: Immunohistochemistry - Anti-IKZF3 Antibody [ARC2781] (A306354)

Immunohistochemistry analysis of paraffin-embedded rat lung using Anti-IKZF3 Antibody [ARC2781] (A306354) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 8: Immunohistochemistry - Anti-IKZF3 Antibody [ARC2781] (A306354)

Immunohistochemistry analysis of paraffin-embedded rat spleen using Anti-IKZF3 Antibody [ARC2781] (A306354) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 9: Immunofluorescence - Anti-IKZF3 Antibody [ARC2781] (A306354)

Immunofluorescence analysis of rat spleen using Anti-IKZF3 Antibody [ARC2781] (A306354) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Cliquez pour ouvrir le point de vue élargi

Figure 10: Western Blot - Anti-IKZF3 Antibody [ARC2781] (A306354)

Immunoprecipitation analysis of 300µg extracts of Raji cells using 3µg of Anti-IKZF3 Antibody [ARC2781] (A306354). This Western blot was performed on the immunoprecipitate using Anti-IKZF3 Antibody [ARC2781] (A306354) at a dilution of 1:500.

Voir plus de photos