Anti-Histone H2B Anticorps [ARC2337] (A306466)

Anti-Histone H2B Antibody [ARC2337]

Rabbit monoclonal [ARC2337] antibody to Histone H2B.

WB, IHC

WB: 1:500-1:1,000, IHC: 1:50-1:200

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 47-126 of human Histone H2B (O60814).

KQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

Rabbit

Monoclonal

ARC2337

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

GL105, H2B, H2B 1A, H2B GL105, H2B histone family, H2B histone family member O, H2B histone family member Q, H2B histone family member S, H2B type 12, H2B-GL105, H2B.1, H2B.1 B, H2b.1A, H2B.b, H2B.c, H2B.d, H2B.e, H2B.f, H2B.j, H2B.q, H2B/a, H2B/b, H2B/c, H2B/d, H2B/e, H2B/f, H2B/g, H2B/h, H2B/j, H2B/l, H2B/o, H2B/q, H2B1_YEAST, H2B2E_HUMAN, H2B2f, H2B2F_HUMAN, H2Ba, H2Bf, H2BFB, H2BFC, H2BFD, H2BFE, H2BFF, H2BFJ, H2BFO, H2BFQ, H2BFS, H2BGL105, H2BQ, HIRIP2, HIST1H2BB, HIST1H2BD, HIST1H2BH, HIST1H2BL, HIST1H2BM, HIST1H2BN, HIST2H2BE, HIST2H2BF, Histone 2 H2be, histone cluster 2, H2be, histone H2B GL105, histone H2B type 1, Histone H2B type 1 B, Histone H2B type 1 D, Histone H2B type 1 H, Histone H2B type 1 L, Histone H2B type 1 M, Histone H2B type 1 N, Histone H2B type 1-B, Histone H2B type 1-C/E/F/G/I, Histone H2B type 1-D, Histone H2B type 1-H, Histone H2B type 1-L, Histone H2B type 1-M, Histone H2B type 1-N, Histone H2B type 2 E, Histone H2B type 2-E, Histone H2B type 2-F, histone H2B type 2E, Histone H2B-GL105, Histone H2B.1, Histone H2B.1 A, Histone H2B.2, Histone H2B.a, Histone H2B.b, Histone H2B.f, Histone H2B.g, Histone H2B.h, Histone H2B.k, Histone H2B.l, Histone H2B.n, Histone H2B.q, histone H2BGL105, histone protein, HTB 1, HTB 2, HTB1, Htb1p, HTB2, Htb2p, MGC131639, SPT 12, SPT12, Suppressor of Ty protein 12