Anti-CXCR4 Anticorps (A13424)

Anti-CXCR4 Antibody

Rabbit polyclonal antibody to CXCR4.

WB

WB: 1:500-1:1,000

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CXCR4 (NP_003458.1).

MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVA

Rabbit

Polyclonal

IgG

Unconjugated

36 kDa / 70 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

C-X-C chemokine receptor type 4, CD184, CD184 antigen, Chemokine (C X C motif) receptor 4, Chemokine CXC Motif Receptor 4, CXC-R4, CXCR-4, CXCR4_HUMAN, D2S201E, FB22, Fusin, HM89, HSY3RR, LAP 3, LAP3, LCR1, LESTR, Leukocyte derived seven transmembrane domain receptor, Leukocyte-derived seven transmembrane domain receptor, Lipopolysaccharide associated protein 3, Neuropeptide Y receptor Y3, NPY3R, NPYR, NPYRL, NPYY3, NPYY3R, Probable G protein coupled receptor lcr1 homolog, SDF 1 receptor, SDF-1 receptor, SEVEN-TRANSMEMBRANE-SEGMENT RECEPTOR, Stromal cell derived factor 1 receptor, Stromal cell-derived factor 1 receptor, WHIM, WHIMS