Anti-CXCL11 Anticorps (A9814)

Anti-CXCL11 Antibody

Rabbit polyclonal antibody to CXCL11.

IHC

IHC: 1:100-1:200

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 22-94 of human CXCL11 (NP_005400.1).

FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

Rabbit

Polyclonal

IgG

Unconjugated

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

b R1, b-R1, Beta R1, Beta-R1, betaR1, C X C motif chemokine 11, C-X-C motif chemokine 11, Chemokine (C-X-C motif) ligand 11, Chemokine C-X-C motif ligand 11, CXC11, CXL11_HUMAN, H174, I TAC, I-TAC, Interferon gamma inducible protein 9, Interferon gamma-inducible protein 9, Interferon inducible T cell a chemoattractant I TAC, Interferon inducible T cell alpha chemoattractant, Interferon-inducible T-cell a chemoattractant I-TAC, Interferon-inducible T-cell alpha chemoattractant, IP 9, IP-9, IP9, ITAC, MGC102770 , SCYB11, SCYB9B, Small inducible cytokine B11, Small inducible cytokine subfamily B (Cys X Cys) member 11 , Small inducible cytokine subfamily B (Cys X Cys) member 9B, Small inducible cytokine subfamily B (Cys-X-Cys) member 11, Small inducible cytokine subfamily B (Cys-X-Cys) member 9B, Small inducible cytokine subfamily B, member 11, Small inducible cytokine subfamily B, member 9B, Small-inducible cytokine B11