Anti-CLECSF6 Anticorps (A9076)

Anti-CLECSF6 Antibody

Rabbit polyclonal antibody to CLECSF6.

WB

WB: 1:500-1:2,000

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLEC4A (Q9UMR7).

MTSEITYAEVRFKNEFKSSGINTASSAASKERTAPHKSNTGFPKLLCASLLIFFLLLAISFFIAFVIFFQKYSQLLEKKTTKELVHTTLECVKKNMPVEE

Rabbit

Polyclonal

IgG

Unconjugated

25 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

C type (calcium dependent carbohydrate recognition domain) lectin superfamily member 6, C type lectin, C type lectin DDB27, C type lectin superfamily 6, C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 6, C-type lectin DDB27, C-type lectin domain family 4 member A, C-type lectin domain family 4, member A, C-type lectin domain family 4, member a2, C-type lectin superfamily member 6, CLC4A_HUMAN, Clec4a, Clec4a2, DCIR, Dcir1, DDB27, Dendritic cell immunoreceptor, HDCGC13P, Lectin like immunoreceptor, Lectin, C-type, superfamily member 6, Lectin-like immunoreceptor, LLIR