Anti-CD40 Anticorps (A12548)

Anti-CD40 Antibody

Rabbit polyclonal antibody to CD40.

WB, IHC, ICC/IF

WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence within amino acids 198-277 of human CD40 (NP_001241.1).

IPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

AI326936, B cell associated molecule , B cell associated molecule CD40, B cell surface antigen CD40 , B cell-associated molecule, B-cell surface antigen CD40, Bp50, CD 40 , CD40 antigen , CD40 antigen (TNF receptor superfamily member 5), CD40 molecule , CD40 molecule TNF receptor superfamily member 5, CD40 molecule, TNF receptor superfamily member 5, CD40 protein , CD40 type II isoform , CD40L receptor , CDw40, GP39 , HIGM1, IGM , IMD3, MGC9013, Nerve growth factor receptor related B lymphocyte activation molecule , NFRSF5 , OTTHUMP00000031699, OTTHUMP00000031700 , p50, T BAM , T-BAM, TBAM, TNF receptor superfamily member 5, TNFRSF5, TNR5_HUMAN, TRAP, Tumor necrosis factor receptor superfamily , member 5, Tumor necrosis factor receptor superfamily member 5, Tumor necrosis factor receptor superfamily member 5 precursor , Tumor necrosis factor receptor superfamily, member 5, isoform CRA_a