Anti-CD30 Anticorps [C03-8D3] (A279933)

Anti-CD30 Antibody [C03-8D3]

Mouse monoclonal [C03-8D3] antibody to CD30.

This antibody recognises the human CD30 cell surface antigen also known as TNFRSF8. CD30 is a 120 kDa, type I transmembrane glycoprotein of the tumour necrosis factor (TNF) receptor superfamily. CD30 was originally identified as a molecule expressed on Hodgkin and Reed Sternberg cells in Hodgkin’s disease but has subsequently been detected on certain non-Hodgkin's malignancies as well as some virally transformed cells. It is also expressed on a subset of activated human T-cells, and by a few extrafollicular T and B-cell blasts in normal lymph nodes. Evidence indicates that CD30 may act as a signal transduction molecule. Binding of CD30 by its ligand induces activation of signalling pathways JNK and NF-?B, expression of lymphocyte genes, proliferation and apoptosis. These and other signalling events of which CD30 is involved contribute to homeostatic regulation of immune responses.

ELISA

Human

E. coli derived recombinant protein corresponding to amino acids 19-595 of human CD30.

FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK

Mouse

Monoclonal

C03-8D3

IgG1

Protein G affinity chromatography of ascites.

1 mg/ml

Liquid

Supplied in Phosphate Buffered Saline with <0.1% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti Human CD30, clone C03-8D3, recognizes the human CD30 cell surface antigen also known as TNFRSF8. CD30 is a 120 kDa, type I transmembrane glycoprotein of the tumour necrosis factor (TNF) receptor superfamily. CD30 was originally identified as a molecule expressed on Hodgkin and Reed Sternberg cells in Hodgkin’s disease but has subsequently been detected on certain non-Hodgkin's malignancies as well as some virally transformed cells. It is also expressed on a subset of activated human T-cells, and by a few extrafollicular T and B-cell blasts in normal lymph nodes. Evidence indicates that CD30 may act as a signal transduction molecule. Binding of CD30 by its ligand induces activation of signalling pathways JNK and NF-?B, expression of lymphocyte genes, proliferation and apoptosis (Muta et al. 2000). These and other signalling events of which CD30 is involved contribute to homeostatic regulation of immune responses (Berghella et al. 2011).

CD 30, CD30 antigen, CD30L receptor, Cytokine receptor CD30, D1S166E, KI 1, KI 1 antigen, Ki-1 antigen, KI1, Lymphocyte activation antigen CD30, TNFRSF 8, Tnfrsf8, TNR8_HUMAN, Tumor necrosis factor receptor superfamily member 8