Anti-c-Myc Anticorps (A13427)

Anti-c-Myc Antibody

Rabbit polyclonal antibody to c-Myc.

WB

WB: 1:100-1:500

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 347-439 of human c-Myc (NP_002458.2).

VLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRR

Rabbit

Polyclonal

IgG

Unconjugated

60 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

AU016757, Avian myelocytomatosis viral oncogene homolog, bHLHe39, c Myc, Class E basic helix-loop-helix protein 39, MRTL, Myc, Myc Epitope Tag, Myc protein, Myc proto oncogene protein, Myc proto-oncogene protein, myc related translation/localization regulatory factor, myc-related translation/localization regulatory factor, Myc2, MYCC, MYC_HUMAN, Myelocytomatosis oncogene, Niard, Nird, oncogene c-Myc, Oncogene Myc, OTTHUMP00000158589, Proto-oncogene c-Myc, Protooncogene homologous to myelocytomatosis virus, RNCMYC, Transcription factor p64, Transcriptional regulator Myc-A, v myc avian myelocytomatosis viral oncogene homolog, v myc myelocytomatosis viral oncogene homolog, V-Myc avian myelocytomatosis viral oncogene homolog, v-myc myelocytomatosis viral oncogene homolog (avian)