Anti-c-Kit Anticorps (A10155)

Anti-c-Kit Antibody

Rabbit polyclonal antibody to c-Kit.

WB, IHC

WB: 1:1,000-1:5,000, IHC: 1:50-1:100

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 25-295 of human CD117/c-Kit (NP_000213.1).

SQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNT

Rabbit

Polyclonal

IgG

Unconjugated

120 kDa / 145 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

C Kit, c-Kit Ligand, CD117, Kit, Kit Ligand, KIT oncogene, KIT proto oncogene receptor tyrosine kinase, KIT_HUMAN, Mast cell growth factor receptor, Mast/stem cell growth factor receptor Kit, Mast/stem cell growth factor receptor precursor, MGF, p145 c-kit, PBT, Piebald trait protein, Proto oncogene c Kit, Proto oncogene tyrosine protein kinase Kit, Proto-oncogene c-Kit, SCF Receptor, SCFR, soluble KIT variant 1, Steel Factor Receptor, Stem cell factor receptor, tyrosine protein kinase Kit, Tyrosine-protein kinase Kit, v kit Hardy Zuckerman 4 feline sarcoma viral oncogene homolog, v kit Hardy Zuckerman 4 feline sarcoma viral oncogene like protein, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog