Anti-Fas Antibody (A90289)

Anti-Fas Antibody

Rabbit polyclonal antibody to Fas.

WB, IHC

WB: 1:500-1:1,000, IHC: 1:50-1:200

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Fas (NP_000034.1).

EGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCE

Rabbit

Polyclonal

IgG

Unconjugated

40 - 50 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

ALPS 1A, ALPS1A, APO 1, Apo 1 antigen, APO 1 cell surface antigen, Apo-1 antigen, APO1, Apo1 antigen, APO1 cell surface antigen, Apoptosis antigen 1, Apoptosis mediating surface antigen FAS, Apoptosis-mediating surface antigen FAS, APT 1, APT1, CD 95, CD 95 antigen, CD95, CD95 antigen , Delta Fas, Delta Fas/APO 1/CD95, Delta Fas/APO1/CD95, Fas (TNF receptor superfamily, member 6), FAS 1, FAS 827dupA, Fas AMA, FAS Antigen, Fas cell surface death receptor, FAS1, FASLG receptor, FASTM, sFAS, Surface antigen APO1, TNF receptor superfamily, member 6, TNFRSF 6, TNFRSF6, TNR6_HUMAN, Tumor necrosis factor receptor superfamily member 6