Anti-Estrogen Receptor alpha Antibody (A11135)

Anti-Estrogen Receptor alpha Antibody

Rabbit polyclonal antibody to Estrogen Receptor alpha.

WB: 1:100-1:500

Human, Mouse, Rat

Recombinant fusion protein containing a sequence within amino acids 516-595 of human ESRa (NP_000116.2).

HMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV

Rabbit

Polyclonal

IgG

Unconjugated

66 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

DKFZp686N23123, ER, ER alpha, ER-alpha, Era, ESR, ESR1, ESR1_HUMAN, ESRA, Estradiol receptor, Estrogen nuclear receptor alpha, Estrogen receptor, Estrogen receptor 1, Estrogen receptor alpha 3*,4,5,6,7*/822 isoform, Estrogen receptor alpha delta 3*,4,5,6,7*,8*/941 isoform, Estrogen receptor alpha delta 3*,4,5,6,7*/819 2 isoform, Estrogen receptor alpha delta 4 +49 isoform, Estrogen receptor alpha delta 4*,5,6,7*/654 isoform, Estrogen receptor alpha delta 4*,5,6,7,8*/901 isoform, Estrogen receptor alpha E1 E2 1 2, Estrogen receptor alpha E1 N2 E2 1 2, ESTRR, NR3A1, Nuclear receptor subfamily 3 group A member 1