Anti-ERAB Antibody [ARC1852] (A308394)

Anti-ERAB Antibody [ARC1852]

Rabbit monoclonal [ARC1852] antibody to ERAB.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 162-261 of human ERAB/HSD17B10 (Q99714).

QVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

Rabbit

Monoclonal

ARC1852

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

17 beta hydroxysteroid dehydrogenase 10, 17 beta hydroxysteroid dehydrogenase type 10, 17-beta-HSD 10, 17-beta-hydroxysteroid dehydrogenase 10, 17b HSD10, 3 hydroxy 2 methylbutyryl CoA dehydrogenase, 3 hydroxyacyl CoA dehydrogenase type 2, 3 hydroxyacyl CoA dehydrogenase type II, 3-hydroxy-2-methylbutyryl-CoA dehydrogenase, 3-hydroxyacyl-CoA dehydrogenase type II, 3-hydroxyacyl-CoA dehydrogenase type-2, AB binding alcohol dehydrogenase, ABAD, Ads9, Amyloid beta binding polypeptide, Amyloid beta peptide binding alcohol dehydrogenase, Amyloid beta peptide binding protein, CAMR, DUPXp11.22, Endoplasmic Reticulum Amyloid Binding Protein, Endoplasmic reticulum associated amyloid beta peptide binding protein, Endoplasmic reticulum-associated amyloid beta-peptide-binding protein, ER associated amyloid beta-binding protein, HADH 2, HADH2, HCD 2, HCD2, HCD2_HUMAN, Hsd17b10, Hydroxyacyl CoA Dehydrogenase type II, Hydroxyacyl Coenzyme A dehydrogenase type II, Hydroxysteroid (17 beta) dehydrogenase 10, Mental retardation X linked syndromic 11, MHBD, Mitochondrial L3 Hydroxyacyl CoA Dehydrogenase, Mitochondrial ribonuclease P protein 2, Mitochondrial RNase P protein 2, MRPP2, MRX17, SCHAD, SDR5C1, Short chain dehydrogenase/reductase family 5C member 1, Short chain L 3 hydroxyacyl CoA dehydrogenase type 2, Short chain type dehydrogenase/reductase XH98G2, Short-chain type dehydrogenase/reductase XH98G2, Type 10 17b HSD, Type 10 17beta hydroxysteroid dehydrogenase, Type II HADH, XH98G2