Anti-ENTPD5 Antibody (A10299)

Anti-ENTPD5 Antibody

Rabbit polyclonal antibody to ENTPD5.

IF: 1:50-1:200

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 149-428 of human ENTPD5 (NP_001240.1).

KEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTLDLGGASTQITFLPQFEKTLEQTPRGYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETEGTDGHTFRSACLPRWLEAEWIFGGVKYQYGGNQEGEVGFEPCYAEVLRVVRGKLHQPEEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQLTKKVNNIETGWALGATFHLLQSLGISH

Rabbit

Polyclonal

Unconjugated

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

AI196558, AI987697, CD39 antigen like 4, CD39 antigen-like 4, CD39 like 4, CD39L4, Ectonucleoside triphosphate diphosphohydrolase 5, ENTP5_HUMAN, ER UDPase, ER-UDPase, GDPase ENTPD5, Guanosine-diphosphatase ENTPD5, MGC163357, MGC163359, mNTPase, NTPDase 5, Nucleoside diphosphatase, PCPH, Pcph proto oncogene protein, Proto oncogene CPH, UDPase ENTPD5, Uridine-diphosphatase ENTPD5