Anti-ELP2 Antibody (A91444)

Anti-ELP2 Antibody

Rabbit polyclonal antibody to ELP2.

WB: 1:500-1:2,000

Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 300-600 of human ELP2 (NP_001229808.1).

QNTVNPREWTPEIVISGHFDGVQDLVWDPEGEFIITVGTDQTTRLFAPWKRKDQSQVTWHEIARPQIHGYDLKCLAMINRFQFVSGADEKVLRVFSAPRNFVENFCAITGQSLNHVLCNQDSDLPEGATVPALGLSNKAVFQGDIASQPSDEEELLTSTGFEYQQVAFQPSILTEPPTEDHLLQNTLWPEVQKLYGHGYEIFCVTCNSSKTLLASACKAAKKEHAAIILWNTTSWKQVQNLVFHSLTVTQMAFSPNEKFLLAVSRDRTWSLWKKQDTISPEFEPVFSLFAFTNKITSVHSR

Rabbit

Polyclonal

IgG

Unconjugated

92 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

AU023723, Elongation protein 2 homolog (S. cerevisiae), Elongator acetyltransferase complex subunit 2, Elongator complex protein 2, elongator protein 2, ELP2_HUMAN, Epl2, FLJ10879, SHINC 2, SHINC-2, SHINC2, signal transducer and activator of transcription 3 interacting protein 1, signal transducer and activator of transcription interacting protein 1, Stat3 interacting protein, STAT3 interacting protein 1, STAT3-interacting protein 1, STATIP 1, STATIP1, STATIP1 protein, StIP, StIP1